Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3613576..3614194 | Replicon | chromosome |
Accession | NZ_CP103745 | ||
Organism | Escherichia coli strain 3090 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | M5T02_RS17465 | Protein ID | WP_001291435.1 |
Coordinates | 3613976..3614194 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | M5T02_RS17460 | Protein ID | WP_000344800.1 |
Coordinates | 3613576..3613950 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T02_RS17450 (3608665) | 3608665..3609858 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M5T02_RS17455 (3609881) | 3609881..3613030 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
M5T02_RS17460 (3613576) | 3613576..3613950 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
M5T02_RS17465 (3613976) | 3613976..3614194 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
M5T02_RS17470 (3614366) | 3614366..3614917 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
M5T02_RS17475 (3615033) | 3615033..3615503 | + | 471 | WP_000136192.1 | YlaC family protein | - |
M5T02_RS17480 (3615667) | 3615667..3617217 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
M5T02_RS17485 (3617259) | 3617259..3617612 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
M5T02_RS17495 (3617991) | 3617991..3618302 | + | 312 | WP_000409911.1 | MGMT family protein | - |
M5T02_RS17500 (3618333) | 3618333..3618905 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T256487 WP_001291435.1 NZ_CP103745:3613976-3614194 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT256487 WP_000344800.1 NZ_CP103745:3613576-3613950 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |