Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2890541..2891339 | Replicon | chromosome |
| Accession | NZ_CP103745 | ||
| Organism | Escherichia coli strain 3090 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q1RDD2 |
| Locus tag | M5T02_RS14025 | Protein ID | WP_001094434.1 |
| Coordinates | 2890541..2890915 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | M5T02_RS14030 | Protein ID | WP_001552747.1 |
| Coordinates | 2890962..2891339 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T02_RS13995 (2886323) | 2886323..2886856 | - | 534 | Protein_2740 | DUF4942 domain-containing protein | - |
| M5T02_RS14000 (2887050) | 2887050..2888591 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| M5T02_RS14005 (2888606) | 2888606..2889352 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| M5T02_RS14010 (2889434) | 2889434..2889751 | - | 318 | Protein_2743 | restriction endonuclease subunit M | - |
| M5T02_RS14015 (2889844) | 2889844..2890041 | - | 198 | WP_000839257.1 | DUF957 domain-containing protein | - |
| M5T02_RS14020 (2890053) | 2890053..2890544 | - | 492 | WP_000976859.1 | DUF5983 family protein | - |
| M5T02_RS14025 (2890541) | 2890541..2890915 | - | 375 | WP_001094434.1 | TA system toxin CbtA family protein | Toxin |
| M5T02_RS14030 (2890962) | 2890962..2891339 | - | 378 | WP_001552747.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| M5T02_RS14035 (2891389) | 2891389..2892033 | - | 645 | WP_000086759.1 | hypothetical protein | - |
| M5T02_RS14040 (2892052) | 2892052..2892273 | - | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
| M5T02_RS14045 (2892336) | 2892336..2892812 | - | 477 | WP_001186774.1 | RadC family protein | - |
| M5T02_RS14050 (2892828) | 2892828..2893301 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| M5T02_RS14055 (2893643) | 2893643..2894461 | - | 819 | WP_087523595.1 | DUF932 domain-containing protein | - |
| M5T02_RS14060 (2894579) | 2894579..2894774 | - | 196 | Protein_2753 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13921.82 Da Isoelectric Point: 6.8517
>T256486 WP_001094434.1 NZ_CP103745:c2890915-2890541 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK
Download Length: 375 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13757.63 Da Isoelectric Point: 6.3127
>AT256486 WP_001552747.1 NZ_CP103745:c2891339-2890962 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRTGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRTGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|