Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2465940..2466578 | Replicon | chromosome |
| Accession | NZ_CP103745 | ||
| Organism | Escherichia coli strain 3090 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
| Locus tag | M5T02_RS11800 | Protein ID | WP_001447010.1 |
| Coordinates | 2466402..2466578 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | M5T02_RS11795 | Protein ID | WP_001270286.1 |
| Coordinates | 2465940..2466356 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T02_RS11775 (2461092) | 2461092..2462033 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
| M5T02_RS11780 (2462034) | 2462034..2463047 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| M5T02_RS11785 (2463065) | 2463065..2464210 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| M5T02_RS11790 (2464455) | 2464455..2465861 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| M5T02_RS11795 (2465940) | 2465940..2466356 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| M5T02_RS11800 (2466402) | 2466402..2466578 | - | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| M5T02_RS11805 (2466800) | 2466800..2467030 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| M5T02_RS11810 (2467122) | 2467122..2469083 | - | 1962 | WP_259429177.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| M5T02_RS11815 (2469156) | 2469156..2469692 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| M5T02_RS11820 (2469784) | 2469784..2470959 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T256485 WP_001447010.1 NZ_CP103745:c2466578-2466402 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT256485 WP_001270286.1 NZ_CP103745:c2466356-2465940 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|