Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1856987..1857818 Replicon chromosome
Accession NZ_CP103745
Organism Escherichia coli strain 3090

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag M5T02_RS08845 Protein ID WP_000854814.1
Coordinates 1856987..1857361 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag M5T02_RS08850 Protein ID WP_001285585.1
Coordinates 1857450..1857818 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T02_RS08805 (1852383) 1852383..1853549 + 1167 WP_000830144.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
M5T02_RS08810 (1853668) 1853668..1854141 + 474 WP_001105416.1 DNA gyrase inhibitor SbmC -
M5T02_RS08815 (1854339) 1854339..1855397 + 1059 WP_001200890.1 FUSC family protein -
M5T02_RS08820 (1855569) 1855569..1855898 + 330 WP_000450409.1 DUF496 family protein -
M5T02_RS08825 (1855999) 1855999..1856133 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
M5T02_RS08830 (1856253) 1856253..1856381 + 129 Protein_1726 transposase domain-containing protein -
M5T02_RS08835 (1856670) 1856670..1856750 - 81 Protein_1727 hypothetical protein -
M5T02_RS08840 (1856796) 1856796..1856990 - 195 WP_000988600.1 DUF5983 family protein -
M5T02_RS08845 (1856987) 1856987..1857361 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
M5T02_RS08850 (1857450) 1857450..1857818 - 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
M5T02_RS08855 (1857892) 1857892..1858113 - 222 WP_000692323.1 DUF987 domain-containing protein -
M5T02_RS08860 (1858176) 1858176..1858652 - 477 WP_001186773.1 RadC family protein -
M5T02_RS08865 (1858668) 1858668..1859147 - 480 WP_000860081.1 antirestriction protein -
M5T02_RS08870 (1859229) 1859229..1860050 - 822 WP_048217813.1 DUF932 domain-containing protein -
M5T02_RS08875 (1860271) 1860271..1860681 - 411 WP_000846713.1 hypothetical protein -
M5T02_RS08880 (1860697) 1860697..1861380 - 684 WP_000775500.1 hypothetical protein -
M5T02_RS08885 (1861516) 1861516..1862586 - 1071 WP_000102644.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T256479 WP_000854814.1 NZ_CP103745:c1857361-1856987 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT256479 WP_001285585.1 NZ_CP103745:c1857818-1857450 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References