Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 922972..923626 | Replicon | chromosome |
Accession | NZ_CP103745 | ||
Organism | Escherichia coli strain 3090 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | M5T02_RS04540 | Protein ID | WP_000244777.1 |
Coordinates | 923219..923626 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | M5T02_RS04535 | Protein ID | WP_000354046.1 |
Coordinates | 922972..923238 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T02_RS04510 (918141) | 918141..918884 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
M5T02_RS04515 (918941) | 918941..920374 | - | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
M5T02_RS04520 (920419) | 920419..920730 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
M5T02_RS04525 (920894) | 920894..921553 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
M5T02_RS04530 (921749) | 921749..922729 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
M5T02_RS04535 (922972) | 922972..923238 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
M5T02_RS04540 (923219) | 923219..923626 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
M5T02_RS04545 (923666) | 923666..924187 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
M5T02_RS04550 (924299) | 924299..925195 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
M5T02_RS04555 (925220) | 925220..925930 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M5T02_RS04560 (925936) | 925936..927669 | + | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T256476 WP_000244777.1 NZ_CP103745:923219-923626 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |