Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 61301..61848 Replicon plasmid pMB2855_2
Accession NZ_CP103744
Organism Escherichia coli O25b:H4-ST131 strain 2822

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag M5R22_RS24955 Protein ID WP_001384452.1
Coordinates 61570..61848 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID K4JYR0
Locus tag M5R22_RS24950 Protein ID WP_000079928.1
Coordinates 61301..61570 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R22_RS24915 (56938) 56938..57150 + 213 WP_001309245.1 ANR family transcriptional regulator -
M5R22_RS24920 (57395) 57395..57856 + 462 WP_016230918.1 thermonuclease family protein -
M5R22_RS24925 (57902) 57902..58111 + 210 WP_001369435.1 hemolysin expression modulator Hha -
M5R22_RS24930 (58149) 58149..58739 + 591 WP_016230919.1 DUF2726 domain-containing protein -
M5R22_RS24935 (58979) 58979..59239 + 261 WP_000083819.1 replication regulatory protein RepA -
M5R22_RS24940 (59463) 59463..59537 + 75 WP_001365705.1 RepA leader peptide Tap -
M5R22_RS24945 (59530) 59530..60387 + 858 WP_042018306.1 incFII family plasmid replication initiator RepA -
M5R22_RS24950 (61301) 61301..61570 + 270 WP_000079928.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
M5R22_RS24955 (61570) 61570..61848 + 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
M5R22_RS24960 (61894) 61894..62742 + 849 WP_016235419.1 3'-5' exonuclease -
M5R22_RS24965 (62859) 62859..63341 + 483 WP_001311056.1 hypothetical protein -
M5R22_RS24970 (63701) 63701..64888 - 1188 Protein_83 IS91 family transposase -
M5R22_RS24975 (64888) 64888..65253 - 366 WP_016235422.1 hypothetical protein -
M5R22_RS24980 (65781) 65781..66290 + 510 WP_000115001.1 peptide deformylase -
M5R22_RS24985 (66305) 66305..66406 + 102 Protein_86 methionyl-tRNA formyltransferase -
M5R22_RS24990 (66603) 66603..66794 + 192 WP_000175572.1 DUF2164 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..72458 72458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T256471 WP_001384452.1 NZ_CP103744:61570-61848 [Escherichia coli O25b:H4-ST131]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10175.50 Da        Isoelectric Point: 7.3210

>AT256471 WP_000079928.1 NZ_CP103744:61301-61570 [Escherichia coli O25b:H4-ST131]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLEHGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A5W2J4D0

References