Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 123992..124593 | Replicon | plasmid pMB2855_1 |
| Accession | NZ_CP103743 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 2822 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | M5R22_RS24500 | Protein ID | WP_001216034.1 |
| Coordinates | 123992..124372 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | M5R22_RS24505 | Protein ID | WP_001190712.1 |
| Coordinates | 124372..124593 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R22_RS24465 (119043) | 119043..119975 | - | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
| M5R22_RS24470 (119962) | 119962..121365 | - | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
| M5R22_RS24475 (121609) | 121609..122589 | + | 981 | WP_000019407.1 | IS5-like element IS5 family transposase | - |
| M5R22_RS24480 (122799) | 122799..123134 | + | 336 | WP_169329198.1 | type I deoxyribonuclease HsdR | - |
| M5R22_RS24485 (123084) | 123084..123497 | - | 414 | Protein_146 | integrase core domain-containing protein | - |
| M5R22_RS24490 (123502) | 123502..123780 | - | 279 | Protein_147 | pdcB | - |
| M5R22_RS24495 (123808) | 123808..123987 | - | 180 | WP_001513661.1 | hypothetical protein | - |
| M5R22_RS24500 (123992) | 123992..124372 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| M5R22_RS24505 (124372) | 124372..124593 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M5R22_RS24510 (124776) | 124776..126332 | + | 1557 | WP_001617892.1 | type I restriction-modification system subunit M | - |
| M5R22_RS24515 (126329) | 126329..127612 | + | 1284 | WP_001617890.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | senB | 1..136642 | 136642 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T256470 WP_001216034.1 NZ_CP103743:c124372-123992 [Escherichia coli O25b:H4-ST131]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |