Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 123992..124593 Replicon plasmid pMB2855_1
Accession NZ_CP103743
Organism Escherichia coli O25b:H4-ST131 strain 2822

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag M5R22_RS24500 Protein ID WP_001216034.1
Coordinates 123992..124372 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag M5R22_RS24505 Protein ID WP_001190712.1
Coordinates 124372..124593 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R22_RS24465 (119043) 119043..119975 - 933 WP_000081352.1 homocysteine S-methyltransferase -
M5R22_RS24470 (119962) 119962..121365 - 1404 WP_001373486.1 S-methylmethionine permease -
M5R22_RS24475 (121609) 121609..122589 + 981 WP_000019407.1 IS5-like element IS5 family transposase -
M5R22_RS24480 (122799) 122799..123134 + 336 WP_169329198.1 type I deoxyribonuclease HsdR -
M5R22_RS24485 (123084) 123084..123497 - 414 Protein_146 integrase core domain-containing protein -
M5R22_RS24490 (123502) 123502..123780 - 279 Protein_147 pdcB -
M5R22_RS24495 (123808) 123808..123987 - 180 WP_001513661.1 hypothetical protein -
M5R22_RS24500 (123992) 123992..124372 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M5R22_RS24505 (124372) 124372..124593 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M5R22_RS24510 (124776) 124776..126332 + 1557 WP_001617892.1 type I restriction-modification system subunit M -
M5R22_RS24515 (126329) 126329..127612 + 1284 WP_001617890.1 restriction endonuclease subunit S -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 senB 1..136642 136642


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T256470 WP_001216034.1 NZ_CP103743:c124372-123992 [Escherichia coli O25b:H4-ST131]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT256470 WP_001190712.1 NZ_CP103743:c124593-124372 [Escherichia coli O25b:H4-ST131]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References