Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4141824..4142658 | Replicon | chromosome |
Accession | NZ_CP103742 | ||
Organism | Escherichia coli O25b:H4-ST131 strain 2822 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
Locus tag | M5R22_RS20270 | Protein ID | WP_000854770.1 |
Coordinates | 4141824..4142201 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A1M1N885 |
Locus tag | M5R22_RS20275 | Protein ID | WP_001280950.1 |
Coordinates | 4142290..4142658 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R22_RS20245 (4137935) | 4137935..4139557 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
M5R22_RS20250 (4140348) | 4140348..4140524 | - | 177 | Protein_3967 | helix-turn-helix domain-containing protein | - |
M5R22_RS20255 (4140891) | 4140891..4141040 | - | 150 | Protein_3968 | hypothetical protein | - |
M5R22_RS20260 (4141146) | 4141146..4141322 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
M5R22_RS20265 (4141339) | 4141339..4141827 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
M5R22_RS20270 (4141824) | 4141824..4142201 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
M5R22_RS20275 (4142290) | 4142290..4142658 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M5R22_RS20280 (4142821) | 4142821..4143042 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
M5R22_RS20285 (4143105) | 4143105..4143581 | - | 477 | WP_001186779.1 | RadC family protein | - |
M5R22_RS20290 (4143597) | 4143597..4144061 | - | 465 | WP_000855061.1 | antirestriction protein | - |
M5R22_RS20295 (4144403) | 4144403..4145221 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
M5R22_RS20300 (4145339) | 4145339..4145534 | - | 196 | Protein_3977 | DUF905 family protein | - |
M5R22_RS20305 (4145605) | 4145605..4147506 | - | 1902 | Protein_3978 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4130178..4170387 | 40209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T256464 WP_000854770.1 NZ_CP103742:c4142201-4141824 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT256464 WP_001280950.1 NZ_CP103742:c4142658-4142290 [Escherichia coli O25b:H4-ST131]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1J6XFW9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M1N885 |