Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4070968..4071544 | Replicon | chromosome |
Accession | NZ_CP103742 | ||
Organism | Escherichia coli O25b:H4-ST131 strain 2822 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | D3GXZ2 |
Locus tag | M5R22_RS19905 | Protein ID | WP_001297643.1 |
Coordinates | 4071257..4071544 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A829G8Z0 |
Locus tag | M5R22_RS19900 | Protein ID | WP_000063156.1 |
Coordinates | 4070968..4071270 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R22_RS19885 (4067564) | 4067564..4069714 | + | 2151 | WP_001295524.1 | pyruvate/proton symporter BtsT | - |
M5R22_RS19890 (4069764) | 4069764..4069967 | + | 204 | WP_000467859.1 | YbdD/YjiX family protein | - |
M5R22_RS19895 (4069978) | 4069978..4070934 | + | 957 | WP_001297640.1 | GTPase | - |
M5R22_RS19900 (4070968) | 4070968..4071270 | - | 303 | WP_000063156.1 | BrnA antitoxin family protein | Antitoxin |
M5R22_RS19905 (4071257) | 4071257..4071544 | - | 288 | WP_001297643.1 | BrnT family toxin | Toxin |
M5R22_RS19910 (4071743) | 4071743..4072440 | - | 698 | Protein_3899 | IS1 family transposase | - |
M5R22_RS19915 (4072497) | 4072497..4072592 | + | 96 | Protein_3900 | dienelactone hydrolase family protein | - |
M5R22_RS19920 (4072738) | 4072738..4073970 | + | 1233 | WP_001339512.1 | multidrug efflux MFS transporter MdtM | - |
M5R22_RS19925 (4074011) | 4074011..4075291 | + | 1281 | WP_001037382.1 | DUF445 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 4071743..4071952 | 209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11295.77 Da Isoelectric Point: 6.8821
>T256463 WP_001297643.1 NZ_CP103742:c4071544-4071257 [Escherichia coli O25b:H4-ST131]
MPMEFEWDENKAKSNRVKHGIRFEDAVLLFDDPQHLSQQERIENGEYRWQTIGLVYGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERNRYEHG
MPMEFEWDENKAKSNRVKHGIRFEDAVLLFDDPQHLSQQERIENGEYRWQTIGLVYGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829GEV9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G8Z0 |