Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3961257..3961807 Replicon chromosome
Accession NZ_CP103742
Organism Escherichia coli O25b:H4-ST131 strain 2822

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag M5R22_RS19360 Protein ID WP_001160966.1
Coordinates 3961257..3961571 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag M5R22_RS19365 Protein ID WP_000125566.1
Coordinates 3961574..3961807 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R22_RS19335 (3956932) 3956932..3958218 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
M5R22_RS19340 (3958218) 3958218..3959207 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
M5R22_RS19345 (3959204) 3959204..3960025 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
M5R22_RS19350 (3960028) 3960028..3960405 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
M5R22_RS19355 (3960412) 3960412..3961260 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
M5R22_RS19360 (3961257) 3961257..3961571 - 315 WP_001160966.1 CcdB family protein Toxin
M5R22_RS19365 (3961574) 3961574..3961807 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
M5R22_RS19370 (3961893) 3961893..3962372 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
M5R22_RS19375 (3962564) 3962564..3964426 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
M5R22_RS19380 (3964419) 3964419..3964949 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
M5R22_RS19385 (3965057) 3965057..3966388 - 1332 WP_001183207.1 MFS transporter -
M5R22_RS19390 (3966447) 3966447..3966734 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T256462 WP_001160966.1 NZ_CP103742:c3961571-3961257 [Escherichia coli O25b:H4-ST131]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT256462 WP_000125566.1 NZ_CP103742:c3961807-3961574 [Escherichia coli O25b:H4-ST131]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References