Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3547656..3548274 | Replicon | chromosome |
| Accession | NZ_CP103742 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 2822 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | M5R22_RS17415 | Protein ID | WP_001291435.1 |
| Coordinates | 3548056..3548274 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | M5R22_RS17410 | Protein ID | WP_000344800.1 |
| Coordinates | 3547656..3548030 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R22_RS17400 (3542745) | 3542745..3543938 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M5R22_RS17405 (3543961) | 3543961..3547110 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| M5R22_RS17410 (3547656) | 3547656..3548030 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| M5R22_RS17415 (3548056) | 3548056..3548274 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| M5R22_RS17420 (3548447) | 3548447..3548998 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| M5R22_RS17425 (3549114) | 3549114..3549584 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| M5R22_RS17430 (3549748) | 3549748..3551298 | + | 1551 | WP_001545832.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| M5R22_RS17435 (3551340) | 3551340..3551693 | - | 354 | WP_000878147.1 | DUF1428 family protein | - |
| M5R22_RS17445 (3552072) | 3552072..3552383 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| M5R22_RS17450 (3552414) | 3552414..3552986 | - | 573 | WP_000779841.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T256460 WP_001291435.1 NZ_CP103742:3548056-3548274 [Escherichia coli O25b:H4-ST131]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT256460 WP_000344800.1 NZ_CP103742:3547656-3548030 [Escherichia coli O25b:H4-ST131]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |