Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | paaR-paaA-parE/- |
| Location | 2843413..2843884 | Replicon | chromosome |
| Accession | NZ_CP103742 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 2822 | ||
Toxin (Protein)
| Gene name | parE_1 | Uniprot ID | A0A0D7C2L1 |
| Locus tag | M5R22_RS13925 | Protein ID | WP_001303511.1 |
| Coordinates | 2843606..2843884 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | paaA | Uniprot ID | Q8XAD5 |
| Locus tag | M5R22_RS13920 | Protein ID | WP_001302048.1 |
| Coordinates | 2843413..2843604 (+) | Length | 64 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R22_RS13875 (2838662) | 2838662..2838880 | - | 219 | WP_001610644.1 | DUF4014 family protein | - |
| M5R22_RS13880 (2838913) | 2838913..2839125 | - | 213 | WP_000072553.1 | hypothetical protein | - |
| M5R22_RS13885 (2839231) | 2839231..2839653 | - | 423 | Protein_2723 | DUF977 family protein | - |
| M5R22_RS13890 (2839669) | 2839669..2840439 | - | 771 | WP_000450998.1 | DUF1627 domain-containing protein | - |
| M5R22_RS13895 (2840461) | 2840461..2841207 | - | 747 | WP_000788950.1 | ATP-binding protein | - |
| M5R22_RS13900 (2841214) | 2841214..2842176 | - | 963 | WP_000095673.1 | helix-turn-helix domain-containing protein | - |
| M5R22_RS13905 (2842199) | 2842199..2842624 | - | 426 | WP_000693943.1 | toxin YdaT family protein | - |
| M5R22_RS13910 (2842621) | 2842621..2842923 | - | 303 | WP_001556930.1 | transcriptional regulator | - |
| M5R22_RS13915 (2843021) | 2843021..2843392 | + | 372 | WP_001169687.1 | hypothetical protein | - |
| M5R22_RS13920 (2843413) | 2843413..2843604 | + | 192 | WP_001302048.1 | hypothetical protein | Antitoxin |
| M5R22_RS13925 (2843606) | 2843606..2843884 | + | 279 | WP_001303511.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5R22_RS13930 (2844175) | 2844175..2844327 | + | 153 | WP_000380313.1 | DUF1391 family protein | - |
| M5R22_RS13935 (2844339) | 2844339..2844677 | + | 339 | WP_000394541.1 | hypothetical protein | - |
| M5R22_RS13940 (2844666) | 2844666..2844860 | - | 195 | WP_001295058.1 | hypothetical protein | - |
| M5R22_RS13945 (2845436) | 2845436..2845624 | + | 189 | WP_000449175.1 | cell division inhibition protein DicB | - |
| M5R22_RS13950 (2845621) | 2845621..2845809 | + | 189 | WP_000199475.1 | DUF1482 family protein | - |
| M5R22_RS13955 (2845902) | 2845902..2848340 | + | 2439 | WP_000102132.1 | exonuclease | - |
| M5R22_RS13960 (2848402) | 2848402..2848671 | + | 270 | WP_000003742.1 | excisionase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2760263..2856926 | 96663 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10661.25 Da Isoelectric Point: 5.5647
>T256458 WP_001303511.1 NZ_CP103742:2843606-2843884 [Escherichia coli O25b:H4-ST131]
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|