Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1877336..1878167 Replicon chromosome
Accession NZ_CP103742
Organism Escherichia coli O25b:H4-ST131 strain 2822

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag M5R22_RS08855 Protein ID WP_000854814.1
Coordinates 1877336..1877710 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag M5R22_RS08860 Protein ID WP_001546021.1
Coordinates 1877799..1878167 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R22_RS08820 (1873331) 1873331..1873660 + 330 WP_000450409.1 DUF496 family protein -
M5R22_RS08825 (1873761) 1873761..1874084 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
M5R22_RS08830 (1874063) 1874063..1874143 + 81 WP_023441679.1 hypothetical protein -
M5R22_RS08835 (1874354) 1874354..1875895 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
M5R22_RS08840 (1875910) 1875910..1876656 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
M5R22_RS08845 (1877019) 1877019..1877099 - 81 Protein_1731 hypothetical protein -
M5R22_RS08850 (1877145) 1877145..1877339 - 195 WP_000988601.1 DUF5983 family protein -
M5R22_RS08855 (1877336) 1877336..1877710 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
M5R22_RS08860 (1877799) 1877799..1878167 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
M5R22_RS08865 (1878247) 1878247..1878468 - 222 WP_000692323.1 DUF987 domain-containing protein -
M5R22_RS08870 (1878531) 1878531..1879007 - 477 WP_001186773.1 RadC family protein -
M5R22_RS08875 (1879023) 1879023..1879496 - 474 WP_001385393.1 antirestriction protein -
M5R22_RS08880 (1879759) 1879759..1880580 - 822 WP_001234710.1 DUF932 domain-containing protein -
M5R22_RS08885 (1880801) 1880801..1881211 - 411 WP_000846704.1 hypothetical protein -
M5R22_RS08890 (1881227) 1881227..1881904 - 678 WP_001362823.1 hypothetical protein -
M5R22_RS08895 (1882040) 1882040..1883110 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T256452 WP_000854814.1 NZ_CP103742:c1877710-1877336 [Escherichia coli O25b:H4-ST131]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT256452 WP_001546021.1 NZ_CP103742:c1878167-1877799 [Escherichia coli O25b:H4-ST131]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References