Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1877336..1878167 | Replicon | chromosome |
Accession | NZ_CP103742 | ||
Organism | Escherichia coli O25b:H4-ST131 strain 2822 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1P968 |
Locus tag | M5R22_RS08855 | Protein ID | WP_000854814.1 |
Coordinates | 1877336..1877710 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A641DSP2 |
Locus tag | M5R22_RS08860 | Protein ID | WP_001546021.1 |
Coordinates | 1877799..1878167 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R22_RS08820 (1873331) | 1873331..1873660 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
M5R22_RS08825 (1873761) | 1873761..1874084 | - | 324 | WP_223216378.1 | EutP/PduV family microcompartment system protein | - |
M5R22_RS08830 (1874063) | 1874063..1874143 | + | 81 | WP_023441679.1 | hypothetical protein | - |
M5R22_RS08835 (1874354) | 1874354..1875895 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
M5R22_RS08840 (1875910) | 1875910..1876656 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
M5R22_RS08845 (1877019) | 1877019..1877099 | - | 81 | Protein_1731 | hypothetical protein | - |
M5R22_RS08850 (1877145) | 1877145..1877339 | - | 195 | WP_000988601.1 | DUF5983 family protein | - |
M5R22_RS08855 (1877336) | 1877336..1877710 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
M5R22_RS08860 (1877799) | 1877799..1878167 | - | 369 | WP_001546021.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
M5R22_RS08865 (1878247) | 1878247..1878468 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
M5R22_RS08870 (1878531) | 1878531..1879007 | - | 477 | WP_001186773.1 | RadC family protein | - |
M5R22_RS08875 (1879023) | 1879023..1879496 | - | 474 | WP_001385393.1 | antirestriction protein | - |
M5R22_RS08880 (1879759) | 1879759..1880580 | - | 822 | WP_001234710.1 | DUF932 domain-containing protein | - |
M5R22_RS08885 (1880801) | 1880801..1881211 | - | 411 | WP_000846704.1 | hypothetical protein | - |
M5R22_RS08890 (1881227) | 1881227..1881904 | - | 678 | WP_001362823.1 | hypothetical protein | - |
M5R22_RS08895 (1882040) | 1882040..1883110 | - | 1071 | WP_000102631.1 | patatin-like phospholipase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T256452 WP_000854814.1 NZ_CP103742:c1877710-1877336 [Escherichia coli O25b:H4-ST131]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13607.47 Da Isoelectric Point: 6.3139
>AT256452 WP_001546021.1 NZ_CP103742:c1878167-1877799 [Escherichia coli O25b:H4-ST131]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FY50 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A641DSP2 |