Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 817976..818810 Replicon chromosome
Accession NZ_CP103742
Organism Escherichia coli O25b:H4-ST131 strain 2822

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag M5R22_RS03970 Protein ID WP_000854690.1
Coordinates 817976..818353 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag M5R22_RS03975 Protein ID WP_001305076.1
Coordinates 818442..818810 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R22_RS03940 (814370) 814370..814540 - 171 Protein_774 IS110 family transposase -
M5R22_RS03945 (814957) 814957..815890 - 934 Protein_775 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
M5R22_RS03950 (815883) 815883..816278 - 396 WP_000208384.1 DUF6088 family protein -
M5R22_RS03955 (816347) 816347..817192 - 846 WP_001529401.1 DUF4942 domain-containing protein -
M5R22_RS03960 (817277) 817277..817474 - 198 WP_000839293.1 DUF957 domain-containing protein -
M5R22_RS03965 (817491) 817491..817979 - 489 WP_000761699.1 DUF5983 family protein -
M5R22_RS03970 (817976) 817976..818353 - 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
M5R22_RS03975 (818442) 818442..818810 - 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5R22_RS03980 (818860) 818860..819504 - 645 WP_000094916.1 hypothetical protein -
M5R22_RS03985 (819523) 819523..819744 - 222 WP_000692329.1 DUF987 domain-containing protein -
M5R22_RS03990 (819807) 819807..820283 - 477 WP_001186726.1 RadC family protein -
M5R22_RS03995 (820299) 820299..820784 - 486 WP_000849565.1 antirestriction protein -
M5R22_RS04000 (820839) 820839..821657 - 819 WP_001234620.1 DUF932 domain-containing protein -
M5R22_RS04005 (821758) 821758..821991 - 234 WP_000902034.1 DUF905 family protein -
M5R22_RS04010 (822070) 822070..822525 - 456 WP_000581502.1 IrmA family protein -
M5R22_RS04015 (822601) 822601..823728 - 1128 Protein_789 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / sat 800079..867022 66943
- flank IS/Tn - - 814370..814525 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T256449 WP_000854690.1 NZ_CP103742:c818353-817976 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT256449 WP_001305076.1 NZ_CP103742:c818810-818442 [Escherichia coli O25b:H4-ST131]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References