Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 817976..818810 | Replicon | chromosome |
| Accession | NZ_CP103742 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 2822 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | M5R22_RS03970 | Protein ID | WP_000854690.1 |
| Coordinates | 817976..818353 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1P7N8 |
| Locus tag | M5R22_RS03975 | Protein ID | WP_001305076.1 |
| Coordinates | 818442..818810 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R22_RS03940 (814370) | 814370..814540 | - | 171 | Protein_774 | IS110 family transposase | - |
| M5R22_RS03945 (814957) | 814957..815890 | - | 934 | Protein_775 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| M5R22_RS03950 (815883) | 815883..816278 | - | 396 | WP_000208384.1 | DUF6088 family protein | - |
| M5R22_RS03955 (816347) | 816347..817192 | - | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
| M5R22_RS03960 (817277) | 817277..817474 | - | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| M5R22_RS03965 (817491) | 817491..817979 | - | 489 | WP_000761699.1 | DUF5983 family protein | - |
| M5R22_RS03970 (817976) | 817976..818353 | - | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| M5R22_RS03975 (818442) | 818442..818810 | - | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5R22_RS03980 (818860) | 818860..819504 | - | 645 | WP_000094916.1 | hypothetical protein | - |
| M5R22_RS03985 (819523) | 819523..819744 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| M5R22_RS03990 (819807) | 819807..820283 | - | 477 | WP_001186726.1 | RadC family protein | - |
| M5R22_RS03995 (820299) | 820299..820784 | - | 486 | WP_000849565.1 | antirestriction protein | - |
| M5R22_RS04000 (820839) | 820839..821657 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| M5R22_RS04005 (821758) | 821758..821991 | - | 234 | WP_000902034.1 | DUF905 family protein | - |
| M5R22_RS04010 (822070) | 822070..822525 | - | 456 | WP_000581502.1 | IrmA family protein | - |
| M5R22_RS04015 (822601) | 822601..823728 | - | 1128 | Protein_789 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / sat | 800079..867022 | 66943 | |
| - | flank | IS/Tn | - | - | 814370..814525 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T256449 WP_000854690.1 NZ_CP103742:c818353-817976 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT256449 WP_001305076.1 NZ_CP103742:c818810-818442 [Escherichia coli O25b:H4-ST131]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|