Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 63003..63604 Replicon plasmid pMB2910_2
Accession NZ_CP103741
Organism Escherichia coli strain 3359

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag M5T33_RS25470 Protein ID WP_001216045.1
Coordinates 63224..63604 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag M5T33_RS25465 Protein ID WP_001190712.1
Coordinates 63003..63224 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T33_RS25430 (M5T33_25430) 58543..58764 + 222 WP_000013838.1 hypothetical protein -
M5T33_RS25435 (M5T33_25435) 58766..58963 + 198 WP_000360279.1 hypothetical protein -
M5T33_RS25440 (M5T33_25440) 58974..59990 + 1017 WP_259431165.1 hypothetical protein -
M5T33_RS25445 (M5T33_25445) 59987..60349 + 363 WP_259431166.1 hypothetical protein -
M5T33_RS25450 (M5T33_25450) 61425..61781 - 357 WP_259431167.1 hypothetical protein -
M5T33_RS25455 (M5T33_25455) 61782..62366 - 585 WP_259431168.1 DNA-binding protein -
M5T33_RS25460 (M5T33_25460) 62541..62930 + 390 WP_000506730.1 S24 family peptidase -
M5T33_RS25465 (M5T33_25465) 63003..63224 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M5T33_RS25470 (M5T33_25470) 63224..63604 + 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M5T33_RS25475 (M5T33_25475) 63609..63788 + 180 WP_000113019.1 hypothetical protein -
M5T33_RS25480 (M5T33_25480) 63816..64859 + 1044 WP_000648827.1 DUF968 domain-containing protein -
M5T33_RS25485 (M5T33_25485) 64948..65400 + 453 WP_259431169.1 Late promoter-activating protein -
M5T33_RS25490 (M5T33_25490) 65487..66680 + 1194 WP_000219604.1 terminase -
M5T33_RS25495 (M5T33_25495) 66722..68164 + 1443 WP_259431170.1 terminase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..96149 96149


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T256444 WP_001216045.1 NZ_CP103741:63224-63604 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT256444 WP_001190712.1 NZ_CP103741:63003-63224 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References