Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4164127..4164928 | Replicon | chromosome |
| Accession | NZ_CP103739 | ||
| Organism | Escherichia coli strain 3359 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | U9ZA48 |
| Locus tag | M5T33_RS20530 | Protein ID | WP_001513431.1 |
| Coordinates | 4164551..4164928 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | U9YYT7 |
| Locus tag | M5T33_RS20525 | Protein ID | WP_001513429.1 |
| Coordinates | 4164127..4164504 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T33_RS20495 (4160958) | 4160958..4161413 | + | 456 | WP_000581502.1 | IrmA family protein | - |
| M5T33_RS20500 (4161556) | 4161556..4161645 | + | 90 | WP_112031555.1 | DUF905 family protein | - |
| M5T33_RS20505 (4161824) | 4161824..4162642 | + | 819 | WP_001513427.1 | DUF932 domain-containing protein | - |
| M5T33_RS20510 (4162697) | 4162697..4163182 | + | 486 | WP_001513428.1 | antirestriction protein | - |
| M5T33_RS20515 (4163198) | 4163198..4163674 | + | 477 | WP_001186726.1 | RadC family protein | - |
| M5T33_RS20520 (4163743) | 4163743..4163964 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| M5T33_RS20525 (4164127) | 4164127..4164504 | + | 378 | WP_001513429.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5T33_RS20530 (4164551) | 4164551..4164928 | + | 378 | WP_001513431.1 | TA system toxin CbtA family protein | Toxin |
| M5T33_RS20535 (4164925) | 4164925..4165354 | + | 430 | Protein_4001 | DUF5983 family protein | - |
| M5T33_RS20540 (4165366) | 4165366..4165563 | + | 198 | WP_001374283.1 | DUF957 domain-containing protein | - |
| M5T33_RS20545 (4165648) | 4165648..4166490 | + | 843 | WP_001513432.1 | DUF4942 domain-containing protein | - |
| M5T33_RS20550 (4166872) | 4166872..4167003 | + | 132 | Protein_4004 | IS110 family transposase | - |
| M5T33_RS20555 (4167813) | 4167813..4168796 | + | 984 | WP_001329577.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13941.80 Da Isoelectric Point: 7.3225
>T256438 WP_001513431.1 NZ_CP103739:4164551-4164928 [Escherichia coli]
MNTLPDTHVREASGCPSPITIRQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ
MNTLPDTHVREASGCPSPITIRQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13688.48 Da Isoelectric Point: 5.9505
>AT256438 WP_001513429.1 NZ_CP103739:4164127-4164504 [Escherichia coli]
VSDTLPGTTPPDDNHDRPWWGLPCTVTSCFGARLVQEGNRLHYLADRAGIRGRFSDVDAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPATTV
VSDTLPGTTPPDDNHDRPWWGLPCTVTSCFGARLVQEGNRLHYLADRAGIRGRFSDVDAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPATTV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|