Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4001227..4001881 | Replicon | chromosome |
| Accession | NZ_CP103739 | ||
| Organism | Escherichia coli strain 3359 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | M5T33_RS19690 | Protein ID | WP_000244781.1 |
| Coordinates | 4001227..4001634 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | M5T33_RS19695 | Protein ID | WP_000354046.1 |
| Coordinates | 4001615..4001881 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T33_RS19670 (3997184) | 3997184..3998917 | - | 1734 | WP_000813233.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| M5T33_RS19675 (3998923) | 3998923..3999633 | - | 711 | WP_000715222.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M5T33_RS19680 (3999658) | 3999658..4000554 | - | 897 | WP_000806650.1 | site-specific tyrosine recombinase XerD | - |
| M5T33_RS19685 (4000666) | 4000666..4001187 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| M5T33_RS19690 (4001227) | 4001227..4001634 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| M5T33_RS19695 (4001615) | 4001615..4001881 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| M5T33_RS19700 (4002124) | 4002124..4003104 | + | 981 | WP_000886088.1 | tRNA-modifying protein YgfZ | - |
| M5T33_RS19705 (4003181) | 4003181..4003840 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| M5T33_RS19710 (4004004) | 4004004..4004315 | - | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| M5T33_RS19715 (4004360) | 4004360..4005793 | + | 1434 | WP_001394742.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T256437 WP_000244781.1 NZ_CP103739:c4001634-4001227 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|