Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2415510..2416148 | Replicon | chromosome |
| Accession | NZ_CP103739 | ||
| Organism | Escherichia coli strain 3359 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | M5T33_RS11995 | Protein ID | WP_000813794.1 |
| Coordinates | 2415510..2415686 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | M5T33_RS12000 | Protein ID | WP_001270286.1 |
| Coordinates | 2415732..2416148 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T33_RS11975 (2411129) | 2411129..2412304 | - | 1176 | WP_001236251.1 | BenE family transporter YdcO | - |
| M5T33_RS11980 (2412396) | 2412396..2412932 | + | 537 | WP_000429133.1 | DNA-binding transcriptional regulator SutR | - |
| M5T33_RS11985 (2413005) | 2413005..2414966 | + | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| M5T33_RS11990 (2415058) | 2415058..2415288 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| M5T33_RS11995 (2415510) | 2415510..2415686 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| M5T33_RS12000 (2415732) | 2415732..2416148 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| M5T33_RS12005 (2416227) | 2416227..2417633 | + | 1407 | WP_000760585.1 | PLP-dependent aminotransferase family protein | - |
| M5T33_RS12010 (2417878) | 2417878..2419023 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| M5T33_RS12015 (2419041) | 2419041..2420054 | + | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
| M5T33_RS12020 (2420055) | 2420055..2420996 | + | 942 | WP_001251313.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T256429 WP_000813794.1 NZ_CP103739:2415510-2415686 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT256429 WP_001270286.1 NZ_CP103739:2415732-2416148 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|