Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
| Location | 109972..110723 | Replicon | plasmid pMB2930_1 |
| Accession | NZ_CP103732 | ||
| Organism | Klebsiella pneumoniae strain 913 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | H6U1U8 |
| Locus tag | M5T23_RS27135 | Protein ID | WP_014386536.1 |
| Coordinates | 109972..110454 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A071LPN3 |
| Locus tag | M5T23_RS27140 | Protein ID | WP_004902250.1 |
| Coordinates | 110445..110723 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T23_RS27115 (M5T23_27115) | 106371..107018 | - | 648 | WP_014386537.1 | EcsC family protein | - |
| M5T23_RS27120 (M5T23_27120) | 107045..107800 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
| M5T23_RS27125 (M5T23_27125) | 107901..108293 | - | 393 | WP_032442757.1 | hypothetical protein | - |
| M5T23_RS27130 (M5T23_27130) | 108398..108937 | - | 540 | WP_004902239.1 | hypothetical protein | - |
| M5T23_RS27135 (M5T23_27135) | 109972..110454 | - | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
| M5T23_RS27140 (M5T23_27140) | 110445..110723 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
| M5T23_RS27145 (M5T23_27145) | 110842..111054 | - | 213 | WP_004902255.1 | hypothetical protein | - |
| M5T23_RS27150 (M5T23_27150) | 111162..111502 | - | 341 | Protein_121 | hypothetical protein | - |
| M5T23_RS27155 (M5T23_27155) | 112332..112790 | - | 459 | WP_014386535.1 | hypothetical protein | - |
| M5T23_RS27160 (M5T23_27160) | 113443..113898 | - | 456 | WP_001166628.1 | Hg(II)-responsive transcriptional regulator | - |
| M5T23_RS27165 (M5T23_27165) | 113970..114335 | + | 366 | WP_032430780.1 | mercuric ion transporter MerT | - |
| M5T23_RS27170 (M5T23_27170) | 114351..114632 | + | 282 | WP_000732277.1 | mercury resistance system periplasmic binding protein MerP | - |
| M5T23_RS27175 (M5T23_27175) | 114660..115067 | + | 408 | WP_000523860.1 | organomercurial transporter MerC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(A) / sul1 / qacE / ant(3'')-Ia / dfrA15 | cheD | 1..180461 | 180461 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T256419 WP_014386536.1 NZ_CP103732:c110454-109972 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A5MBI1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A071LPN3 |