Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4824186..4825021 Replicon chromosome
Accession NZ_CP103731
Organism Klebsiella pneumoniae strain 913

Toxin (Protein)


Gene name yeeV Uniprot ID A0A5E2RWI0
Locus tag M5T23_RS23575 Protein ID WP_001559913.1
Coordinates 4824186..4824563 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A5E3EVB5
Locus tag M5T23_RS23580 Protein ID WP_032408847.1
Coordinates 4824653..4825021 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T23_RS23535 (4819451) 4819451..4819717 + 267 WP_004178415.1 hypothetical protein -
M5T23_RS23540 (4819717) 4819717..4820389 + 673 Protein_4616 DUF4400 domain-containing protein -
M5T23_RS23545 (4820400) 4820400..4821116 + 717 WP_223203127.1 RES domain-containing protein -
M5T23_RS23550 (4821484) 4821484..4821672 - 189 Protein_4618 transposase -
M5T23_RS23555 (4821689) 4821689..4822800 - 1112 Protein_4619 IS3 family transposase -
M5T23_RS23560 (4823250) 4823250..4823399 - 150 Protein_4620 restriction endonuclease subunit M -
M5T23_RS23565 (4823484) 4823484..4823681 - 198 WP_032408848.1 DUF957 domain-containing protein -
M5T23_RS23570 (4823701) 4823701..4824189 - 489 WP_001559914.1 DUF5983 family protein -
M5T23_RS23575 (4824186) 4824186..4824563 - 378 WP_001559913.1 TA system toxin CbtA family protein Toxin
M5T23_RS23580 (4824653) 4824653..4825021 - 369 WP_032408847.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5T23_RS23585 (4825198) 4825198..4825419 - 222 WP_000692300.1 DUF987 domain-containing protein -
M5T23_RS23590 (4825488) 4825488..4825964 - 477 WP_032408846.1 RadC family protein -
M5T23_RS23595 (4825979) 4825979..4826464 - 486 WP_032408845.1 antirestriction protein -
M5T23_RS23600 (4826556) 4826556..4827374 - 819 WP_001559911.1 DUF932 domain-containing protein -
M5T23_RS23605 (4827474) 4827474..4827707 - 234 WP_001119729.1 DUF905 family protein -
M5T23_RS23610 (4827786) 4827786..4828241 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4812563..4844043 31480


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14148.10 Da        Isoelectric Point: 7.8276

>T256413 WP_001559913.1 NZ_CP103731:c4824563-4824186 [Klebsiella pneumoniae]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13682.62 Da        Isoelectric Point: 7.8398

>AT256413 WP_032408847.1 NZ_CP103731:c4825021-4824653 [Klebsiella pneumoniae]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVMLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5E2RWI0

Antitoxin

Source ID Structure
AlphaFold DB A0A5E3EVB5

References