Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4151277..4151896 Replicon chromosome
Accession NZ_CP103731
Organism Klebsiella pneumoniae strain 913

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M5T23_RS20375 Protein ID WP_002892050.1
Coordinates 4151678..4151896 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M5T23_RS20370 Protein ID WP_002892066.1
Coordinates 4151277..4151651 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T23_RS20360 (4146429) 4146429..4147622 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M5T23_RS20365 (4147645) 4147645..4150791 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M5T23_RS20370 (4151277) 4151277..4151651 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M5T23_RS20375 (4151678) 4151678..4151896 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M5T23_RS20380 (4152055) 4152055..4152621 + 567 WP_002892030.1 maltose O-acetyltransferase -
M5T23_RS20385 (4152593) 4152593..4152733 - 141 WP_004147370.1 hypothetical protein -
M5T23_RS20390 (4152754) 4152754..4153224 + 471 WP_002892026.1 YlaC family protein -
M5T23_RS20395 (4153199) 4153199..4154650 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M5T23_RS20400 (4154751) 4154751..4155449 + 699 WP_002892021.1 GNAT family protein -
M5T23_RS20405 (4155446) 4155446..4155586 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M5T23_RS20410 (4155586) 4155586..4155849 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T256411 WP_002892050.1 NZ_CP103731:4151678-4151896 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT256411 WP_002892066.1 NZ_CP103731:4151277-4151651 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References