Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4151277..4151896 | Replicon | chromosome |
Accession | NZ_CP103731 | ||
Organism | Klebsiella pneumoniae strain 913 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | M5T23_RS20375 | Protein ID | WP_002892050.1 |
Coordinates | 4151678..4151896 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | M5T23_RS20370 | Protein ID | WP_002892066.1 |
Coordinates | 4151277..4151651 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T23_RS20360 (4146429) | 4146429..4147622 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M5T23_RS20365 (4147645) | 4147645..4150791 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
M5T23_RS20370 (4151277) | 4151277..4151651 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
M5T23_RS20375 (4151678) | 4151678..4151896 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
M5T23_RS20380 (4152055) | 4152055..4152621 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
M5T23_RS20385 (4152593) | 4152593..4152733 | - | 141 | WP_004147370.1 | hypothetical protein | - |
M5T23_RS20390 (4152754) | 4152754..4153224 | + | 471 | WP_002892026.1 | YlaC family protein | - |
M5T23_RS20395 (4153199) | 4153199..4154650 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
M5T23_RS20400 (4154751) | 4154751..4155449 | + | 699 | WP_002892021.1 | GNAT family protein | - |
M5T23_RS20405 (4155446) | 4155446..4155586 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
M5T23_RS20410 (4155586) | 4155586..4155849 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T256411 WP_002892050.1 NZ_CP103731:4151678-4151896 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT256411 WP_002892066.1 NZ_CP103731:4151277-4151651 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |