Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 144059..144795 Replicon plasmid pMB2966_1
Accession NZ_CP103730
Organism Klebsiella pneumoniae strain 197

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag M5R33_RS26855 Protein ID WP_003026803.1
Coordinates 144059..144541 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag M5R33_RS26860 Protein ID WP_003026799.1
Coordinates 144529..144795 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R33_RS26830 (M5R33_26830) 139134..139622 + 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -
M5R33_RS26835 (M5R33_26835) 139609..140571 + 963 WP_004152113.1 zinc metalloprotease HtpX -
M5R33_RS26840 (M5R33_26840) 140748..141913 + 1166 Protein_145 IS3 family transposase -
M5R33_RS26845 (M5R33_26845) 142061..142456 - 396 WP_004143398.1 helix-turn-helix domain-containing protein -
M5R33_RS26850 (M5R33_26850) 142505..143851 - 1347 WP_077253535.1 ISNCY family transposase -
M5R33_RS26855 (M5R33_26855) 144059..144541 - 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
M5R33_RS26860 (M5R33_26860) 144529..144795 - 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
M5R33_RS26865 (M5R33_26865) 144971..145225 - 255 WP_004152108.1 hypothetical protein -
M5R33_RS26870 (M5R33_26870) 145301..145558 - 258 WP_004152107.1 hypothetical protein -
M5R33_RS26875 (M5R33_26875) 145607..145810 - 204 WP_004152106.1 HHA domain-containing protein -
M5R33_RS26880 (M5R33_26880) 145844..146212 - 369 WP_004152105.1 hypothetical protein -
M5R33_RS26885 (M5R33_26885) 146256..146750 - 495 WP_004152104.1 DNA-binding protein -
M5R33_RS26890 (M5R33_26890) 146781..147356 - 576 WP_004152103.1 hypothetical protein -
M5R33_RS26895 (M5R33_26895) 147344..147613 - 270 WP_004152102.1 hypothetical protein -
M5R33_RS26900 (M5R33_26900) 147971..148321 + 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
M5R33_RS26905 (M5R33_26905) 148371..148733 + 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / tet(A) / qnrB1 / dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 - 1..262225 262225


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T256401 WP_003026803.1 NZ_CP103730:c144541-144059 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT256401 WP_003026799.1 NZ_CP103730:c144795-144529 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References