Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5231867..5232492 | Replicon | chromosome |
| Accession | NZ_CP103729 | ||
| Organism | Klebsiella pneumoniae strain 197 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | M5R33_RS25750 | Protein ID | WP_002882817.1 |
| Coordinates | 5231867..5232250 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | M5R33_RS25755 | Protein ID | WP_004150355.1 |
| Coordinates | 5232250..5232492 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R33_RS25735 (5229233) | 5229233..5230135 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| M5R33_RS25740 (5230132) | 5230132..5230767 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| M5R33_RS25745 (5230764) | 5230764..5231693 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| M5R33_RS25750 (5231867) | 5231867..5232250 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5R33_RS25755 (5232250) | 5232250..5232492 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| M5R33_RS25760 (5232697) | 5232697..5233614 | + | 918 | WP_064150666.1 | alpha/beta hydrolase | - |
| M5R33_RS25765 (5233629) | 5233629..5234570 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| M5R33_RS25770 (5234615) | 5234615..5235052 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| M5R33_RS25775 (5235049) | 5235049..5235909 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| M5R33_RS25780 (5235903) | 5235903..5236502 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T256400 WP_002882817.1 NZ_CP103729:c5232250-5231867 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GPK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |