Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4718999..4719515 | Replicon | chromosome |
Accession | NZ_CP103729 | ||
Organism | Klebsiella pneumoniae strain 197 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | M5R33_RS23320 | Protein ID | WP_040237797.1 |
Coordinates | 4718999..4719283 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | M5R33_RS23325 | Protein ID | WP_002886901.1 |
Coordinates | 4719273..4719515 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R33_RS23295 (4714394) | 4714394..4714657 | - | 264 | WP_228938441.1 | PTS sugar transporter subunit IIB | - |
M5R33_RS23300 (4714787) | 4714787..4714960 | + | 174 | WP_032408826.1 | hypothetical protein | - |
M5R33_RS23305 (4714963) | 4714963..4715706 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
M5R33_RS23310 (4716063) | 4716063..4718201 | + | 2139 | WP_040164650.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M5R33_RS23315 (4718531) | 4718531..4718995 | + | 465 | WP_004192393.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M5R33_RS23320 (4718999) | 4718999..4719283 | - | 285 | WP_040237797.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5R33_RS23325 (4719273) | 4719273..4719515 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M5R33_RS23330 (4719593) | 4719593..4721503 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
M5R33_RS23335 (4721526) | 4721526..4722680 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
M5R33_RS23340 (4722747) | 4722747..4723487 | - | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11067.91 Da Isoelectric Point: 10.4962
>T256398 WP_040237797.1 NZ_CP103729:c4719283-4718999 [Klebsiella pneumoniae]
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|