Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4005321..4005940 Replicon chromosome
Accession NZ_CP103729
Organism Klebsiella pneumoniae strain 197

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M5R33_RS19935 Protein ID WP_002892050.1
Coordinates 4005722..4005940 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M5R33_RS19930 Protein ID WP_002892066.1
Coordinates 4005321..4005695 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R33_RS19920 (4000473) 4000473..4001666 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M5R33_RS19925 (4001689) 4001689..4004835 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M5R33_RS19930 (4005321) 4005321..4005695 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M5R33_RS19935 (4005722) 4005722..4005940 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M5R33_RS19940 (4006099) 4006099..4006665 + 567 WP_002892030.1 maltose O-acetyltransferase -
M5R33_RS19945 (4006637) 4006637..4006777 - 141 WP_004147370.1 hypothetical protein -
M5R33_RS19950 (4006798) 4006798..4007268 + 471 WP_002892026.1 YlaC family protein -
M5R33_RS19955 (4007243) 4007243..4008694 - 1452 WP_064149956.1 PLP-dependent aminotransferase family protein -
M5R33_RS19960 (4008795) 4008795..4009493 + 699 WP_002892021.1 GNAT family protein -
M5R33_RS19965 (4009490) 4009490..4009630 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M5R33_RS19970 (4009630) 4009630..4009893 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T256396 WP_002892050.1 NZ_CP103729:4005722-4005940 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT256396 WP_002892066.1 NZ_CP103729:4005321-4005695 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References