Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4005321..4005940 | Replicon | chromosome |
Accession | NZ_CP103729 | ||
Organism | Klebsiella pneumoniae strain 197 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | M5R33_RS19935 | Protein ID | WP_002892050.1 |
Coordinates | 4005722..4005940 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | M5R33_RS19930 | Protein ID | WP_002892066.1 |
Coordinates | 4005321..4005695 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R33_RS19920 (4000473) | 4000473..4001666 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M5R33_RS19925 (4001689) | 4001689..4004835 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
M5R33_RS19930 (4005321) | 4005321..4005695 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
M5R33_RS19935 (4005722) | 4005722..4005940 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
M5R33_RS19940 (4006099) | 4006099..4006665 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
M5R33_RS19945 (4006637) | 4006637..4006777 | - | 141 | WP_004147370.1 | hypothetical protein | - |
M5R33_RS19950 (4006798) | 4006798..4007268 | + | 471 | WP_002892026.1 | YlaC family protein | - |
M5R33_RS19955 (4007243) | 4007243..4008694 | - | 1452 | WP_064149956.1 | PLP-dependent aminotransferase family protein | - |
M5R33_RS19960 (4008795) | 4008795..4009493 | + | 699 | WP_002892021.1 | GNAT family protein | - |
M5R33_RS19965 (4009490) | 4009490..4009630 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
M5R33_RS19970 (4009630) | 4009630..4009893 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T256396 WP_002892050.1 NZ_CP103729:4005722-4005940 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT256396 WP_002892066.1 NZ_CP103729:4005321-4005695 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |