Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 11120..11763 | Replicon | plasmid pMB3028_1 |
| Accession | NZ_CP103728 | ||
| Organism | Klebsiella pneumoniae strain 2289 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | M5T50_RS25335 | Protein ID | WP_016236302.1 |
| Coordinates | 11347..11763 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | M5T50_RS25330 | Protein ID | WP_001261282.1 |
| Coordinates | 11120..11350 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T50_RS25305 (M5T50_25305) | 6835..7092 | - | 258 | WP_023292103.1 | hypothetical protein | - |
| M5T50_RS25310 (M5T50_25310) | 7571..8299 | + | 729 | Protein_6 | CSS-motif domain-containing protein | - |
| M5T50_RS25315 (M5T50_25315) | 8315..9151 | + | 837 | WP_032439674.1 | EAL domain-containing protein | - |
| M5T50_RS25320 (M5T50_25320) | 9769..10200 | - | 432 | WP_174805835.1 | hypothetical protein | - |
| M5T50_RS25325 (M5T50_25325) | 10741..11163 | - | 423 | WP_046624301.1 | hypothetical protein | - |
| M5T50_RS25330 (M5T50_25330) | 11120..11350 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M5T50_RS25335 (M5T50_25335) | 11347..11763 | + | 417 | WP_016236302.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5T50_RS25340 (M5T50_25340) | 11837..13399 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
| M5T50_RS25345 (M5T50_25345) | 13384..14406 | + | 1023 | WP_032439672.1 | helicase UvrD | - |
| M5T50_RS25350 (M5T50_25350) | 14951..15859 | + | 909 | WP_032439686.1 | HNH endonuclease | - |
| M5T50_RS25355 (M5T50_25355) | 16045..16395 | - | 351 | WP_004187110.1 | DUF305 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaCTX-M-15 / dfrA14 / aac(3)-IIa / qnrB1 / tet(A) | - | 1..152422 | 152422 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15091.55 Da Isoelectric Point: 7.1084
>T256386 WP_016236302.1 NZ_CP103728:11347-11763 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|