Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4606629..4607145 | Replicon | chromosome |
Accession | NZ_CP103727 | ||
Organism | Klebsiella pneumoniae strain 2289 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2XDK6 |
Locus tag | M5T50_RS22660 | Protein ID | WP_002886902.1 |
Coordinates | 4606629..4606913 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | M5T50_RS22665 | Protein ID | WP_002886901.1 |
Coordinates | 4606903..4607145 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T50_RS22635 (4602045) | 4602045..4602308 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
M5T50_RS22640 (4602438) | 4602438..4602611 | + | 174 | WP_032410138.1 | hypothetical protein | - |
M5T50_RS22645 (4602614) | 4602614..4603357 | + | 744 | WP_021441079.1 | MurR/RpiR family transcriptional regulator | - |
M5T50_RS22650 (4603714) | 4603714..4605852 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M5T50_RS22655 (4606161) | 4606161..4606625 | + | 465 | WP_023302390.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M5T50_RS22660 (4606629) | 4606629..4606913 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5T50_RS22665 (4606903) | 4606903..4607145 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M5T50_RS22670 (4607223) | 4607223..4609133 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
M5T50_RS22675 (4609156) | 4609156..4610310 | - | 1155 | WP_023302389.1 | lactonase family protein | - |
M5T50_RS22680 (4610377) | 4610377..4611117 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T256383 WP_002886902.1 NZ_CP103727:c4606913-4606629 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GMH2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |