Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3896358..3896977 Replicon chromosome
Accession NZ_CP103727
Organism Klebsiella pneumoniae strain 2289

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M5T50_RS19265 Protein ID WP_002892050.1
Coordinates 3896759..3896977 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M5T50_RS19260 Protein ID WP_002892066.1
Coordinates 3896358..3896732 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T50_RS19250 (3891510) 3891510..3892703 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M5T50_RS19255 (3892726) 3892726..3895872 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M5T50_RS19260 (3896358) 3896358..3896732 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M5T50_RS19265 (3896759) 3896759..3896977 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M5T50_RS19270 (3897136) 3897136..3897702 + 567 WP_002892030.1 maltose O-acetyltransferase -
M5T50_RS19275 (3897674) 3897674..3897814 - 141 WP_004147370.1 hypothetical protein -
M5T50_RS19280 (3897835) 3897835..3898305 + 471 WP_002892026.1 YlaC family protein -
M5T50_RS19285 (3898280) 3898280..3899731 - 1452 WP_023302231.1 PLP-dependent aminotransferase family protein -
M5T50_RS19290 (3899832) 3899832..3900530 + 699 WP_002892021.1 GNAT family protein -
M5T50_RS19295 (3900527) 3900527..3900667 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M5T50_RS19300 (3900667) 3900667..3900930 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T256381 WP_002892050.1 NZ_CP103727:3896759-3896977 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT256381 WP_002892066.1 NZ_CP103727:3896358-3896732 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References