Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 96883..97526 Replicon plasmid pMB3093_1
Accession NZ_CP103723
Organism Enterobacter hormaechei strain 3131

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag M5R19_RS23965 Protein ID WP_001044770.1
Coordinates 96883..97299 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag M5R19_RS23970 Protein ID WP_001261282.1
Coordinates 97296..97526 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R19_RS23935 (M5R19_23935) 92142..92627 + 486 WP_000045622.1 conjugative transfer protein MobI(A/C) -
M5R19_RS23940 (M5R19_23940) 92624..92989 + 366 WP_001515713.1 hypothetical protein -
M5R19_RS23945 (M5R19_23945) 93090..93311 - 222 Protein_116 IS5/IS1182 family transposase -
M5R19_RS23950 (M5R19_23950) 93365..94059 + 695 WP_085949432.1 IS1-like element IS1N family transposase -
M5R19_RS23955 (M5R19_23955) 94240..95262 - 1023 WP_259425894.1 DNA helicase UvrD -
M5R19_RS23960 (M5R19_23960) 95247..96809 - 1563 WP_004206609.1 AAA family ATPase -
M5R19_RS23965 (M5R19_23965) 96883..97299 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
M5R19_RS23970 (M5R19_23970) 97296..97526 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M5R19_RS23975 (M5R19_23975) 97483..97944 + 462 WP_162919213.1 hypothetical protein -
M5R19_RS23980 (M5R19_23980) 98105..99049 + 945 WP_011977810.1 hypothetical protein -
M5R19_RS23985 (M5R19_23985) 99086..99478 + 393 WP_011977811.1 hypothetical protein -
M5R19_RS23990 (M5R19_23990) 99536..100057 + 522 WP_011977812.1 hypothetical protein -
M5R19_RS23995 (M5R19_23995) 100103..100306 + 204 WP_011977813.1 hypothetical protein -
M5R19_RS24000 (M5R19_24000) 100336..101340 + 1005 WP_011977814.1 hypothetical protein -
M5R19_RS24005 (M5R19_24005) 101524..102303 + 780 WP_013214009.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid qnrS1 - 1..105371 105371


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T256372 WP_001044770.1 NZ_CP103723:c97299-96883 [Enterobacter hormaechei]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT256372 WP_001261282.1 NZ_CP103723:c97526-97296 [Enterobacter hormaechei]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References