Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 4788335..4788951 | Replicon | chromosome |
Accession | NZ_CP103722 | ||
Organism | Enterobacter hormaechei strain 3131 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M5R19_RS22970 | Protein ID | WP_015569913.1 |
Coordinates | 4788335..4788706 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
Locus tag | M5R19_RS22975 | Protein ID | WP_015569912.1 |
Coordinates | 4788709..4788951 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R19_RS22955 (M5R19_22955) | 4785835..4786737 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
M5R19_RS22960 (M5R19_22960) | 4786734..4787369 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
M5R19_RS22965 (M5R19_22965) | 4787366..4788295 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
M5R19_RS22970 (M5R19_22970) | 4788335..4788706 | - | 372 | WP_015569913.1 | PIN domain-containing protein | Toxin |
M5R19_RS22975 (M5R19_22975) | 4788709..4788951 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
M5R19_RS22980 (M5R19_22980) | 4789150..4790070 | + | 921 | WP_015569911.1 | alpha/beta hydrolase | - |
M5R19_RS22985 (M5R19_22985) | 4790079..4791020 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
M5R19_RS22990 (M5R19_22990) | 4791065..4791502 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
M5R19_RS22995 (M5R19_22995) | 4791499..4792380 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
M5R19_RS23000 (M5R19_23000) | 4792374..4792973 | - | 600 | WP_003861947.1 | glucose-1-phosphatase | - |
M5R19_RS23005 (M5R19_23005) | 4793092..4793892 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13767.90 Da Isoelectric Point: 6.4882
>T256371 WP_015569913.1 NZ_CP103722:c4788706-4788335 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|