Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3901653..3902310 | Replicon | chromosome |
Accession | NZ_CP103722 | ||
Organism | Enterobacter hormaechei strain 3131 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A179PSF7 |
Locus tag | M5R19_RS18760 | Protein ID | WP_017382887.1 |
Coordinates | 3901653..3902063 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | G8LDB7 |
Locus tag | M5R19_RS18765 | Protein ID | WP_003863437.1 |
Coordinates | 3902044..3902310 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R19_RS18740 (M5R19_18740) | 3897651..3899384 | - | 1734 | WP_023304383.1 | single-stranded-DNA-specific exonuclease RecJ | - |
M5R19_RS18745 (M5R19_18745) | 3899390..3900103 | - | 714 | WP_023295380.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M5R19_RS18750 (M5R19_18750) | 3900132..3901028 | - | 897 | WP_023304385.1 | site-specific tyrosine recombinase XerD | - |
M5R19_RS18755 (M5R19_18755) | 3901130..3901651 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
M5R19_RS18760 (M5R19_18760) | 3901653..3902063 | - | 411 | WP_017382887.1 | protein YgfX | Toxin |
M5R19_RS18765 (M5R19_18765) | 3902044..3902310 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
M5R19_RS18770 (M5R19_18770) | 3902605..3903585 | + | 981 | WP_022649306.1 | tRNA-modifying protein YgfZ | - |
M5R19_RS18775 (M5R19_18775) | 3903697..3904356 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
M5R19_RS18780 (M5R19_18780) | 3904623..3905354 | + | 732 | WP_015571796.1 | MurR/RpiR family transcriptional regulator | - |
M5R19_RS18785 (M5R19_18785) | 3905471..3906904 | + | 1434 | WP_017382891.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T256370 WP_017382887.1 NZ_CP103722:c3902063-3901653 [Enterobacter hormaechei]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A179PSF7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837F8P5 |