Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2427824..2428563 | Replicon | chromosome |
Accession | NZ_CP103722 | ||
Organism | Enterobacter hormaechei strain 3131 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A822W909 |
Locus tag | M5R19_RS11665 | Protein ID | WP_017382345.1 |
Coordinates | 2427824..2428309 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A837FCR9 |
Locus tag | M5R19_RS11670 | Protein ID | WP_003857131.1 |
Coordinates | 2428297..2428563 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R19_RS11645 (M5R19_11645) | 2423240..2424601 | - | 1362 | WP_000482601.1 | FRG domain-containing protein | - |
M5R19_RS11650 (M5R19_11650) | 2424615..2425418 | - | 804 | WP_000589340.1 | hypothetical protein | - |
M5R19_RS11655 (M5R19_11655) | 2425477..2426823 | - | 1347 | WP_076611902.1 | ISNCY-like element ISLad2 family transposase | - |
M5R19_RS11660 (M5R19_11660) | 2427204..2427773 | + | 570 | WP_017382346.1 | hypothetical protein | - |
M5R19_RS11665 (M5R19_11665) | 2427824..2428309 | - | 486 | WP_017382345.1 | GNAT family N-acetyltransferase | Toxin |
M5R19_RS11670 (M5R19_11670) | 2428297..2428563 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
M5R19_RS11675 (M5R19_11675) | 2428627..2429537 | - | 911 | Protein_2281 | LysR family transcriptional regulator | - |
M5R19_RS11680 (M5R19_11680) | 2429667..2431055 | + | 1389 | WP_032619651.1 | MFS transporter | - |
M5R19_RS11685 (M5R19_11685) | 2431077..2432072 | - | 996 | WP_023303746.1 | DUF2891 domain-containing protein | - |
M5R19_RS11690 (M5R19_11690) | 2432082..2433068 | - | 987 | WP_017382341.1 | DUF979 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2425477..2426835 | 1358 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17510.21 Da Isoelectric Point: 9.9658
>T256364 WP_017382345.1 NZ_CP103722:c2428309-2427824 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARAFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARAFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A822W909 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FCR9 |