Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 108907..109626 | Replicon | chromosome |
| Accession | NZ_CP103722 | ||
| Organism | Enterobacter hormaechei strain 3131 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A144XIR2 |
| Locus tag | M5R19_RS00540 | Protein ID | WP_023305176.1 |
| Coordinates | 108907..109227 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | M5R19_RS00545 | Protein ID | WP_032620726.1 |
| Coordinates | 109261..109626 (-) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R19_RS00500 (M5R19_00500) | 104181..104624 | + | 444 | WP_017383639.1 | GNAT family N-acetyltransferase | - |
| M5R19_RS00505 (M5R19_00505) | 104657..105244 | - | 588 | WP_229692504.1 | hypothetical protein | - |
| M5R19_RS00510 (M5R19_00510) | 105241..105606 | - | 366 | WP_023302859.1 | DUF2778 domain-containing protein | - |
| M5R19_RS00515 (M5R19_00515) | 105616..106101 | - | 486 | WP_017383637.1 | type VI secretion system tube protein TssD | - |
| M5R19_RS00520 (M5R19_00520) | 106365..107393 | - | 1029 | WP_071842900.1 | RhuM family protein | - |
| M5R19_RS00525 (M5R19_00525) | 107452..107793 | - | 342 | WP_032620730.1 | SymE family type I addiction module toxin | - |
| M5R19_RS00530 (M5R19_00530) | 107930..108121 | + | 192 | WP_032620729.1 | toxin-antitoxin system HicB family antitoxin | - |
| M5R19_RS00535 (M5R19_00535) | 108294..108704 | - | 411 | WP_229692505.1 | hypothetical protein | - |
| M5R19_RS00540 (M5R19_00540) | 108907..109227 | - | 321 | WP_023305176.1 | TA system toxin CbtA family protein | Toxin |
| M5R19_RS00545 (M5R19_00545) | 109261..109626 | - | 366 | WP_032620726.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5R19_RS00550 (M5R19_00550) | 109658..109879 | - | 222 | WP_032620724.1 | DUF987 domain-containing protein | - |
| M5R19_RS00555 (M5R19_00555) | 109888..110358 | - | 471 | WP_032620722.1 | DNA repair protein RadC | - |
| M5R19_RS00560 (M5R19_00560) | 110428..111253 | - | 826 | Protein_111 | DUF932 domain-containing protein | - |
| M5R19_RS00565 (M5R19_00565) | 111946..112785 | - | 840 | WP_050595703.1 | hypothetical protein | - |
| M5R19_RS00570 (M5R19_00570) | 112898..113332 | - | 435 | WP_044488933.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 101739..136695 | 34956 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12190.77 Da Isoelectric Point: 5.9559
>T256362 WP_023305176.1 NZ_CP103722:c109227-108907 [Enterobacter hormaechei]
MHISTVPATVTVSSRLSPVQVWQKLLTYILEHHYGLTINDTPFSNDTTIQEHIEAGVNLTDAVNFLVERFELVRIDQKGF
SWQDQEPWITSLDVHRAQFNLGLKRS
MHISTVPATVTVSSRLSPVQVWQKLLTYILEHHYGLTINDTPFSNDTTIQEHIEAGVNLTDAVNFLVERFELVRIDQKGF
SWQDQEPWITSLDVHRAQFNLGLKRS
Download Length: 321 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13574.29 Da Isoelectric Point: 6.4673
>AT256362 WP_032620726.1 NZ_CP103722:c109626-109261 [Enterobacter hormaechei]
MQSTTISGTSAENTSCLQWELKRNITPCFGARLVQESNRLYFLADRAGFNGSFSDDEALRLDQAFPLMMKQLERMLTAGE
LDPRSQHCVTRHHNGLTCEADTLGSHGYVYIAIYPQSALTR
MQSTTISGTSAENTSCLQWELKRNITPCFGARLVQESNRLYFLADRAGFNGSFSDDEALRLDQAFPLMMKQLERMLTAGE
LDPRSQHCVTRHHNGLTCEADTLGSHGYVYIAIYPQSALTR
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|