Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 19917..20476 Replicon plasmid pMB3176_2
Accession NZ_CP103720
Organism Escherichia coli strain 1579

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag M5S87_RS26295 Protein ID WP_000421257.1
Coordinates 20201..20476 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A5I3EQ05
Locus tag M5S87_RS26290 Protein ID WP_001674495.1
Coordinates 19917..20201 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S87_RS26270 (15111) 15111..16514 + 1404 WP_016230922.1 FAD-dependent tricarballylate dehydrogenase TcuA -
M5S87_RS26275 (16501) 16501..17640 + 1140 WP_032179954.1 tricarballylate utilization 4Fe-4S protein TcuB -
M5S87_RS26280 (17695) 17695..18990 + 1296 WP_032190702.1 tricarballylate/proton symporter TcuC -
M5S87_RS26285 (19304) 19304..19517 + 214 Protein_17 Tn3 family transposase -
M5S87_RS26290 (19917) 19917..20201 + 285 WP_001674495.1 ribbon-helix-helix domain-containing protein Antitoxin
M5S87_RS26295 (20201) 20201..20476 + 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M5S87_RS26300 (20582) 20582..20677 + 96 Protein_20 hypothetical protein -
M5S87_RS26305 (20812) 20812..20910 - 99 Protein_21 proQ/FINO family protein -
M5S87_RS26310 (20939) 20939..21907 + 969 WP_162745993.1 IS5-like element IS903B family transposase -
M5S87_RS26315 (21965) 21965..22078 + 114 Protein_23 colicin-like pore-forming protein -
M5S87_RS26320 (22100) 22100..22435 - 336 WP_181041662.1 colicin E1 family microcin immunity protein -
M5S87_RS26325 (22564) 22564..22911 + 348 WP_016230895.1 DUF6404 family protein -
M5S87_RS26330 (22929) 22929..23519 - 591 WP_000194548.1 hypothetical protein -
M5S87_RS26335 (23519) 23519..23776 - 258 WP_000371887.1 hypothetical protein -
M5S87_RS26340 (24105) 24105..24557 + 453 WP_000670961.1 acyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..83426 83426
- flank IS/Tn - - 20984..21907 923


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T256357 WP_000421257.1 NZ_CP103720:20201-20476 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT256357 WP_001674495.1 NZ_CP103720:19917-20201 [Escherichia coli]
MQMKNNSAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A5I3EQ05

References