Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 94894..95495 Replicon plasmid pMB3176_1
Accession NZ_CP103719
Organism Escherichia coli strain 1579

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag M5S87_RS25375 Protein ID WP_001216045.1
Coordinates 95115..95495 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag M5S87_RS25370 Protein ID WP_001190712.1
Coordinates 94894..95115 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S87_RS25315 (89978) 89978..90238 + 261 Protein_116 hypothetical protein -
M5S87_RS25320 (90653) 90653..90820 + 168 WP_233042539.1 hypothetical protein -
M5S87_RS25325 (90903) 90903..91136 + 234 WP_000517421.1 hypothetical protein -
M5S87_RS25330 (91315) 91315..91608 + 294 WP_000269001.1 hypothetical protein -
M5S87_RS25335 (91615) 91615..91989 + 375 WP_000988655.1 hypothetical protein -
M5S87_RS25340 (91971) 91971..92744 + 774 WP_237764467.1 hypothetical protein -
M5S87_RS25345 (92790) 92790..93056 + 267 WP_023356287.1 hypothetical protein -
M5S87_RS25350 (93059) 93059..93298 + 240 WP_023356286.1 DNA polymerase III subunit theta -
M5S87_RS25355 (93310) 93310..93672 - 363 WP_042102765.1 hypothetical protein -
M5S87_RS25360 (93673) 93673..94257 - 585 WP_059229134.1 hypothetical protein -
M5S87_RS25365 (94432) 94432..94821 + 390 WP_000506730.1 S24 family peptidase -
M5S87_RS25370 (94894) 94894..95115 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M5S87_RS25375 (95115) 95115..95495 + 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M5S87_RS25380 (95500) 95500..95679 + 180 WP_000113018.1 hypothetical protein -
M5S87_RS25385 (95707) 95707..96750 + 1044 WP_000648833.1 DUF968 domain-containing protein -
M5S87_RS25390 (96839) 96839..97291 + 453 WP_001312282.1 late promoter-activating protein (Gp10) -
M5S87_RS25395 (97378) 97378..98571 + 1194 WP_000219605.1 terminase -
M5S87_RS25400 (98613) 98613..100055 + 1443 WP_223656860.1 terminase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul1 / qacE / aadA5 / dfrA17 / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / mph(A) / tet(B) - 1..250715 250715


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T256353 WP_001216045.1 NZ_CP103719:95115-95495 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT256353 WP_001190712.1 NZ_CP103719:94894-95115 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References