Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4632158..4632993 | Replicon | chromosome |
| Accession | NZ_CP103718 | ||
| Organism | Escherichia coli strain 1579 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J1YPH7 |
| Locus tag | M5S87_RS22430 | Protein ID | WP_029701676.1 |
| Coordinates | 4632616..4632993 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0K5N986 |
| Locus tag | M5S87_RS22425 | Protein ID | WP_021553056.1 |
| Coordinates | 4632158..4632526 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S87_RS22390 (4627820) | 4627820..4628500 | + | 681 | WP_029702103.1 | WYL domain-containing protein | - |
| M5S87_RS22395 (4628648) | 4628648..4629325 | + | 678 | WP_001097302.1 | hypothetical protein | - |
| M5S87_RS22400 (4629331) | 4629331..4629564 | + | 234 | WP_001278293.1 | DUF905 family protein | - |
| M5S87_RS22405 (4629654) | 4629654..4630472 | + | 819 | WP_001175165.1 | DUF932 domain-containing protein | - |
| M5S87_RS22410 (4630738) | 4630738..4631217 | + | 480 | WP_001564060.1 | antirestriction protein | - |
| M5S87_RS22415 (4631233) | 4631233..4631709 | + | 477 | WP_021553055.1 | RadC family protein | - |
| M5S87_RS22420 (4631774) | 4631774..4631995 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| M5S87_RS22425 (4632158) | 4632158..4632526 | + | 369 | WP_021553056.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5S87_RS22430 (4632616) | 4632616..4632993 | + | 378 | WP_029701676.1 | TA system toxin CbtA family protein | Toxin |
| M5S87_RS22435 (4632990) | 4632990..4633139 | + | 150 | Protein_4391 | DUF5983 family protein | - |
| M5S87_RS22440 (4633218) | 4633218..4633412 | + | 195 | WP_024181941.1 | DUF957 domain-containing protein | - |
| M5S87_RS22445 (4633497) | 4633497..4634339 | + | 843 | WP_022645115.1 | DUF4942 domain-containing protein | - |
| M5S87_RS22450 (4635088) | 4635088..4636626 | + | 1539 | WP_001187196.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14066.04 Da Isoelectric Point: 7.8045
>T256344 WP_029701676.1 NZ_CP103718:4632616-4632993 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13615.39 Da Isoelectric Point: 7.0264
>AT256344 WP_021553056.1 NZ_CP103718:4632158-4632526 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1YPH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K5N986 |