Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4471477..4472072 | Replicon | chromosome |
| Accession | NZ_CP103718 | ||
| Organism | Escherichia coli strain 1579 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | V0SXT4 |
| Locus tag | M5S87_RS21550 | Protein ID | WP_000239581.1 |
| Coordinates | 4471477..4471827 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | L4JJX7 |
| Locus tag | M5S87_RS21555 | Protein ID | WP_001223213.1 |
| Coordinates | 4471821..4472072 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S87_RS21530 (4466931) | 4466931..4467953 | - | 1023 | WP_001361374.1 | ABC transporter permease | - |
| M5S87_RS21535 (4467967) | 4467967..4469469 | - | 1503 | WP_001522399.1 | sugar ABC transporter ATP-binding protein | - |
| M5S87_RS21540 (4469602) | 4469602..4470558 | - | 957 | WP_001522398.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| M5S87_RS21545 (4470868) | 4470868..4471398 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| M5S87_RS21550 (4471477) | 4471477..4471827 | - | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
| M5S87_RS21555 (4471821) | 4471821..4472072 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| M5S87_RS21560 (4472284) | 4472284..4472625 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| M5S87_RS21565 (4472628) | 4472628..4476407 | - | 3780 | WP_001522396.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T256343 WP_000239581.1 NZ_CP103718:c4471827-4471477 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|