Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4459936..4460458 | Replicon | chromosome |
Accession | NZ_CP103718 | ||
Organism | Escherichia coli strain 1579 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A829L6G8 |
Locus tag | M5S87_RS21490 | Protein ID | WP_001105433.1 |
Coordinates | 4459936..4460226 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V0SC69 |
Locus tag | M5S87_RS21495 | Protein ID | WP_000212715.1 |
Coordinates | 4460216..4460458 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S87_RS21475 (4455099) | 4455099..4456754 | + | 1656 | WP_021523332.1 | alpha,alpha-phosphotrehalase | - |
M5S87_RS21480 (4457148) | 4457148..4459286 | + | 2139 | WP_000187798.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M5S87_RS21485 (4459471) | 4459471..4459935 | + | 465 | WP_001009182.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M5S87_RS21490 (4459936) | 4459936..4460226 | - | 291 | WP_001105433.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5S87_RS21495 (4460216) | 4460216..4460458 | - | 243 | WP_000212715.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M5S87_RS21500 (4460650) | 4460650..4461036 | - | 387 | WP_001232246.1 | cytochrome b562 | - |
M5S87_RS21505 (4461220) | 4461220..4462572 | - | 1353 | WP_001162173.1 | metalloprotease PmbA | - |
M5S87_RS21510 (4462666) | 4462666..4463217 | + | 552 | WP_000166270.1 | ribosome biogenesis factor YjgA | - |
M5S87_RS21515 (4463369) | 4463369..4464742 | - | 1374 | WP_001522402.1 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11367.23 Da Isoelectric Point: 10.0238
>T256342 WP_001105433.1 NZ_CP103718:c4460226-4459936 [Escherichia coli]
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829L6G8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9H4B3 |