Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3751115..3751733 | Replicon | chromosome |
Accession | NZ_CP103718 | ||
Organism | Escherichia coli strain 1579 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | M5S87_RS18120 | Protein ID | WP_001291435.1 |
Coordinates | 3751515..3751733 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | M5S87_RS18115 | Protein ID | WP_000344800.1 |
Coordinates | 3751115..3751489 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S87_RS18105 (3746204) | 3746204..3747397 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M5S87_RS18110 (3747420) | 3747420..3750569 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
M5S87_RS18115 (3751115) | 3751115..3751489 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
M5S87_RS18120 (3751515) | 3751515..3751733 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
M5S87_RS18125 (3751905) | 3751905..3752456 | + | 552 | WP_001522034.1 | maltose O-acetyltransferase | - |
M5S87_RS18130 (3752572) | 3752572..3753042 | + | 471 | WP_001490888.1 | YlaC family protein | - |
M5S87_RS18135 (3753206) | 3753206..3754756 | + | 1551 | WP_001577872.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
M5S87_RS18140 (3754798) | 3754798..3755151 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
M5S87_RS18150 (3755530) | 3755530..3755841 | + | 312 | WP_000409911.1 | MGMT family protein | - |
M5S87_RS18155 (3755872) | 3755872..3756444 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T256338 WP_001291435.1 NZ_CP103718:3751515-3751733 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT256338 WP_000344800.1 NZ_CP103718:3751115-3751489 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |