Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3327954..3328659 | Replicon | chromosome |
Accession | NZ_CP103718 | ||
Organism | Escherichia coli strain 1579 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | M5S87_RS16250 | Protein ID | WP_000539521.1 |
Coordinates | 3327954..3328340 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M5S87_RS16255 | Protein ID | WP_001280945.1 |
Coordinates | 3328330..3328659 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S87_RS16230 (3323958) | 3323958..3324584 | + | 627 | WP_020233670.1 | glutathione S-transferase GstB | - |
M5S87_RS16235 (3324581) | 3324581..3325696 | - | 1116 | WP_000555050.1 | aldose sugar dehydrogenase YliI | - |
M5S87_RS16240 (3325807) | 3325807..3326190 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
M5S87_RS16245 (3326403) | 3326403..3327728 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
M5S87_RS16250 (3327954) | 3327954..3328340 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5S87_RS16255 (3328330) | 3328330..3328659 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
M5S87_RS16260 (3328729) | 3328729..3330057 | - | 1329 | WP_000086873.1 | GGDEF domain-containing protein | - |
M5S87_RS16265 (3330065) | 3330065..3332413 | - | 2349 | WP_021523051.1 | EAL domain-containing protein | - |
M5S87_RS16270 (3332591) | 3332591..3333502 | - | 912 | WP_001236019.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T256337 WP_000539521.1 NZ_CP103718:3327954-3328340 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|