Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2647290..2647816 | Replicon | chromosome |
Accession | NZ_CP103718 | ||
Organism | Escherichia coli strain 1579 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | M5S87_RS12825 | Protein ID | WP_000323025.1 |
Coordinates | 2647290..2647577 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | M5S87_RS12830 | Protein ID | WP_000534858.1 |
Coordinates | 2647577..2647816 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S87_RS12780 (2642374) | 2642374..2642832 | - | 459 | WP_000526135.1 | IS200/IS605-like element IS200C family transposase | - |
M5S87_RS12785 (2643283) | 2643283..2643498 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
M5S87_RS12790 (2643799) | 2643799..2644011 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
M5S87_RS12795 (2644066) | 2644066..2644155 | + | 90 | WP_120795389.1 | hypothetical protein | - |
M5S87_RS12800 (2644433) | 2644433..2645185 | - | 753 | WP_001047135.1 | antitermination protein | - |
M5S87_RS12805 (2645199) | 2645199..2646248 | - | 1050 | WP_001265199.1 | DUF968 domain-containing protein | - |
M5S87_RS12810 (2646250) | 2646250..2646528 | - | 279 | WP_012304870.1 | hypothetical protein | - |
M5S87_RS12815 (2646595) | 2646595..2646846 | - | 252 | WP_000980994.1 | protein Rem | - |
M5S87_RS12820 (2647063) | 2647063..2647218 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
M5S87_RS12825 (2647290) | 2647290..2647577 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
M5S87_RS12830 (2647577) | 2647577..2647816 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
M5S87_RS12835 (2647841) | 2647841..2648146 | + | 306 | WP_001326990.1 | protein YdfV | - |
M5S87_RS12840 (2648349) | 2648349..2648681 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
M5S87_RS12845 (2649118) | 2649118..2649267 | - | 150 | WP_011443592.1 | protein YdfW | - |
M5S87_RS12850 (2649388) | 2649388..2650410 | - | 1023 | Protein_2520 | ISNCY family transposase | - |
M5S87_RS12855 (2650915) | 2650915..2651937 | - | 1023 | WP_000915483.1 | DUF4868 domain-containing protein | - |
M5S87_RS12860 (2651940) | 2651940..2652554 | - | 615 | WP_001265627.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2613686..2682506 | 68820 | |
- | flank | IS/Tn | - | - | 2642374..2642832 | 458 | |
- | inside | Prophage | - | - | 2613686..2665041 | 51355 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T256331 WP_000323025.1 NZ_CP103718:c2647577-2647290 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|