Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hipBA/HipA-HipB |
Location | 2450957..2451918 | Replicon | chromosome |
Accession | NZ_CP103718 | ||
Organism | Escherichia coli strain 1579 |
Toxin (Protein)
Gene name | hipA | Uniprot ID | A0A1Q5ZNB7 |
Locus tag | M5S87_RS11890 | Protein ID | WP_021523084.1 |
Coordinates | 2451223..2451918 (+) | Length | 232 a.a. |
Antitoxin (Protein)
Gene name | hipB | Uniprot ID | - |
Locus tag | M5S87_RS11885 | Protein ID | WP_001296726.1 |
Coordinates | 2450957..2451223 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S87_RS11885 (2450957) | 2450957..2451223 | + | 267 | WP_001296726.1 | type II toxin-antitoxin system antitoxin HipB | Antitoxin |
M5S87_RS11890 (2451223) | 2451223..2451918 | + | 696 | WP_021523084.1 | HipA N-terminal domain-containing protein | Toxin |
M5S87_RS11895 (2452118) | 2452118..2453470 | - | 1353 | WP_001551127.1 | SIR2 family protein | - |
M5S87_RS11900 (2453685) | 2453685..2454717 | - | 1033 | Protein_2330 | ISNCY family transposase | - |
M5S87_RS11905 (2455084) | 2455084..2455983 | - | 900 | WP_001523294.1 | LysR family transcriptional regulator | - |
M5S87_RS11910 (2456122) | 2456122..2456430 | + | 309 | WP_001221046.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2453685..2454503 | 818 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 232 a.a. Molecular weight: 25773.79 Da Isoelectric Point: 9.9928
>T256329 WP_021523084.1 NZ_CP103718:2451223-2451918 [Escherichia coli]
MPKLVTWMNNQRVGELTKLANGAHTFKYAPEWLANRYARPLSLSLPLQRGNITSDAVFNFFDNLLPDSPIVRDRIVKRYH
AKSRQPFDLLSEIGRDSVGAVTLIPEDETIQAGGSYRLTPFYDIISAFPVLGGAGIHISDLKLAMGVNASKGKKTAIDKI
YPRHFLATAKVLKFPEVQMHEILSDFARMIPAALDNVKTSLPTDFPENVVTAVETNVLRLHGRLSREYGIK
MPKLVTWMNNQRVGELTKLANGAHTFKYAPEWLANRYARPLSLSLPLQRGNITSDAVFNFFDNLLPDSPIVRDRIVKRYH
AKSRQPFDLLSEIGRDSVGAVTLIPEDETIQAGGSYRLTPFYDIISAFPVLGGAGIHISDLKLAMGVNASKGKKTAIDKI
YPRHFLATAKVLKFPEVQMHEILSDFARMIPAALDNVKTSLPTDFPENVVTAVETNVLRLHGRLSREYGIK
Download Length: 696 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|