Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2031345..2032129 | Replicon | chromosome |
Accession | NZ_CP103718 | ||
Organism | Escherichia coli strain 1579 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | M5S87_RS09620 | Protein ID | WP_000613626.1 |
Coordinates | 2031345..2031839 (-) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | L4JCW6 |
Locus tag | M5S87_RS09625 | Protein ID | WP_001110447.1 |
Coordinates | 2031836..2032129 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S87_RS09600 (2026538) | 2026538..2027635 | + | 1098 | WP_000589326.1 | flagellar basal body P-ring protein FlgI | - |
M5S87_RS09605 (2027635) | 2027635..2028576 | + | 942 | WP_001522863.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
M5S87_RS09610 (2028642) | 2028642..2030285 | + | 1644 | WP_001522865.1 | flagellar hook-associated protein FlgK | - |
M5S87_RS09615 (2030297) | 2030297..2031250 | + | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
M5S87_RS09620 (2031345) | 2031345..2031839 | - | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
M5S87_RS09625 (2031836) | 2031836..2032129 | - | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
M5S87_RS09630 (2032262) | 2032262..2035447 | - | 3186 | WP_001522867.1 | ribonuclease E | - |
M5S87_RS09635 (2036020) | 2036020..2036979 | + | 960 | WP_000846343.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T256324 WP_000613626.1 NZ_CP103718:c2031839-2031345 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|