Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 837264..838098 | Replicon | chromosome |
| Accession | NZ_CP103718 | ||
| Organism | Escherichia coli strain 1579 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A8E0IX31 |
| Locus tag | M5S87_RS03975 | Protein ID | WP_000854689.1 |
| Coordinates | 837264..837641 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A8E0IVP8 |
| Locus tag | M5S87_RS03980 | Protein ID | WP_001285599.1 |
| Coordinates | 837718..838098 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S87_RS03945 (833658) | 833658..833828 | - | 171 | Protein_774 | IS110 family transposase | - |
| M5S87_RS03950 (834245) | 834245..835178 | - | 934 | Protein_775 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| M5S87_RS03955 (835171) | 835171..835566 | - | 396 | WP_000208381.1 | DUF6088 family protein | - |
| M5S87_RS03960 (835635) | 835635..836480 | - | 846 | WP_001446750.1 | DUF4942 domain-containing protein | - |
| M5S87_RS03965 (836565) | 836565..836762 | - | 198 | WP_000839250.1 | DUF957 domain-containing protein | - |
| M5S87_RS03970 (836779) | 836779..837267 | - | 489 | WP_000761698.1 | DUF5983 family protein | - |
| M5S87_RS03975 (837264) | 837264..837641 | - | 378 | WP_000854689.1 | TA system toxin CbtA family protein | Toxin |
| M5S87_RS03980 (837718) | 837718..838098 | - | 381 | WP_001285599.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5S87_RS03985 (838148) | 838148..838792 | - | 645 | WP_000086757.1 | hypothetical protein | - |
| M5S87_RS03990 (838811) | 838811..839032 | - | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
| M5S87_RS03995 (839095) | 839095..839571 | - | 477 | WP_001186761.1 | RadC family protein | - |
| M5S87_RS04000 (839587) | 839587..840060 | - | 474 | WP_001538139.1 | antirestriction protein | - |
| M5S87_RS04005 (840324) | 840324..841145 | - | 822 | WP_001234555.1 | DUF932 domain-containing protein | - |
| M5S87_RS04010 (841324) | 841324..841413 | - | 90 | WP_225385657.1 | DUF905 family protein | - |
| M5S87_RS04015 (841556) | 841556..842011 | - | 456 | WP_001309747.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 833658..833813 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14042.07 Da Isoelectric Point: 9.1510
>T256320 WP_000854689.1 NZ_CP103718:c837641-837264 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13984.78 Da Isoelectric Point: 5.0823
>AT256320 WP_001285599.1 NZ_CP103718:c838098-837718 [Escherichia coli]
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLLQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLLQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|