Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 13166..13631 Replicon plasmid pMB3242_2
Accession NZ_CP103716
Organism Klebsiella pneumoniae strain ST15

Toxin (Protein)


Gene name TsxA Uniprot ID U9ZUY2
Locus tag M5T51_RS25875 Protein ID WP_001230707.1
Coordinates 13166..13417 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID M7CCF8
Locus tag M5T51_RS25880 Protein ID WP_000801440.1
Coordinates 13404..13631 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T51_RS25850 (M5T51_25850) 8567..9433 - 867 WP_049290656.1 replication initiation protein -
M5T51_RS25855 (M5T51_25855) 10688..11023 + 336 WP_001147119.1 type II toxin-antitoxin system RelE/ParE family toxin -
M5T51_RS25860 (M5T51_25860) 11020..11370 + 351 WP_000127482.1 addiction module antitoxin -
M5T51_RS25865 (M5T51_25865) 12008..12523 + 516 WP_001025395.1 J domain-containing protein -
M5T51_RS25870 (M5T51_25870) 12627..13169 + 543 WP_049290658.1 hypothetical protein -
M5T51_RS25875 (M5T51_25875) 13166..13417 + 252 WP_001230707.1 hypothetical protein Toxin
M5T51_RS25880 (M5T51_25880) 13404..13631 + 228 WP_000801440.1 hypothetical protein Antitoxin
M5T51_RS25885 (M5T51_25885) 14086..14385 + 300 WP_000650311.1 hypothetical protein -
M5T51_RS25890 (M5T51_25890) 14477..14827 + 351 WP_000854261.1 hypothetical protein -
M5T51_RS25895 (M5T51_25895) 15066..15290 + 225 WP_016238963.1 type II toxin-antitoxin system HicB family antitoxin -
M5T51_RS25900 (M5T51_25900) 15653..16156 + 504 WP_000781818.1 DNA distortion polypeptide 1 -
M5T51_RS25905 (M5T51_25905) 16160..17389 + 1230 WP_049290883.1 DNA relaxase/nickase TaxC -
M5T51_RS25910 (M5T51_25910) 17466..17759 + 294 WP_000134733.1 sigma factor-like helix-turn-helix DNA-binding protein -
M5T51_RS25915 (M5T51_25915) 17756..17971 + 216 WP_000760375.1 EexN family lipoprotein -
M5T51_RS25920 (M5T51_25920) 18148..18324 + 177 WP_000660496.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..34150 34150


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9751.13 Da        Isoelectric Point: 8.9187

>T256317 WP_001230707.1 NZ_CP103716:13166-13417 [Klebsiella pneumoniae]
MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDAVLNENELQHIDFTCAGLREDDETPVKNLIKEFMLN
ETR

Download         Length: 252 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8659.98 Da        Isoelectric Point: 8.5105

>AT256317 WP_000801440.1 NZ_CP103716:13404-13631 [Klebsiella pneumoniae]
MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQNSQSLSLVEFEFLLLLAGEHPEYVLCKRESK

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9ZUY2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Y6U8W9

References