Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4696388..4696904 | Replicon | chromosome |
Accession | NZ_CP103714 | ||
Organism | Klebsiella pneumoniae strain ST15 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | M5T51_RS22725 | Protein ID | WP_004178374.1 |
Coordinates | 4696388..4696672 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | M5T51_RS22730 | Protein ID | WP_002886901.1 |
Coordinates | 4696662..4696904 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T51_RS22700 (4691872) | 4691872..4692135 | - | 264 | WP_020324507.1 | PTS system, lactose/cellobiose-specific IIB subunit | - |
M5T51_RS22705 (4692265) | 4692265..4692438 | + | 174 | WP_032408826.1 | hypothetical protein | - |
M5T51_RS22710 (4692441) | 4692441..4693184 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
M5T51_RS22715 (4693541) | 4693541..4695679 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M5T51_RS22720 (4695920) | 4695920..4696384 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M5T51_RS22725 (4696388) | 4696388..4696672 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5T51_RS22730 (4696662) | 4696662..4696904 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M5T51_RS22735 (4696982) | 4696982..4698892 | - | 1911 | WP_004178373.1 | PRD domain-containing protein | - |
M5T51_RS22740 (4698915) | 4698915..4700069 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
M5T51_RS22745 (4700136) | 4700136..4700876 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T256314 WP_004178374.1 NZ_CP103714:c4696672-4696388 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |