Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3957776..3958395 Replicon chromosome
Accession NZ_CP103714
Organism Klebsiella pneumoniae strain ST15

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M5T51_RS19285 Protein ID WP_002892050.1
Coordinates 3958177..3958395 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M5T51_RS19280 Protein ID WP_002892066.1
Coordinates 3957776..3958150 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T51_RS19270 (3952928) 3952928..3954121 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M5T51_RS19275 (3954144) 3954144..3957290 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M5T51_RS19280 (3957776) 3957776..3958150 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M5T51_RS19285 (3958177) 3958177..3958395 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M5T51_RS19290 (3958554) 3958554..3959120 + 567 WP_002892030.1 maltose O-acetyltransferase -
M5T51_RS19295 (3959092) 3959092..3959232 - 141 WP_004147370.1 hypothetical protein -
M5T51_RS19300 (3959253) 3959253..3959723 + 471 WP_002892026.1 YlaC family protein -
M5T51_RS19305 (3959698) 3959698..3961149 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M5T51_RS19310 (3961250) 3961250..3961948 + 699 WP_002892021.1 GNAT family protein -
M5T51_RS19315 (3961945) 3961945..3962085 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M5T51_RS19320 (3962085) 3962085..3962348 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T256312 WP_002892050.1 NZ_CP103714:3958177-3958395 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT256312 WP_002892066.1 NZ_CP103714:3957776-3958150 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References