Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 833891..834548 | Replicon | chromosome |
Accession | NZ_CP103714 | ||
Organism | Klebsiella pneumoniae strain ST15 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | M5T51_RS04115 | Protein ID | WP_002916310.1 |
Coordinates | 834138..834548 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | M5T51_RS04110 | Protein ID | WP_002916312.1 |
Coordinates | 833891..834157 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T51_RS04085 (829047) | 829047..830480 | - | 1434 | WP_020324925.1 | 6-phospho-beta-glucosidase | - |
M5T51_RS04090 (830599) | 830599..831327 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
M5T51_RS04095 (831377) | 831377..831688 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
M5T51_RS04100 (831852) | 831852..832511 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
M5T51_RS04105 (832662) | 832662..833645 | - | 984 | WP_020324927.1 | tRNA-modifying protein YgfZ | - |
M5T51_RS04110 (833891) | 833891..834157 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
M5T51_RS04115 (834138) | 834138..834548 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
M5T51_RS04120 (834555) | 834555..835076 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
M5T51_RS04125 (835177) | 835177..836073 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
M5T51_RS04130 (836096) | 836096..836809 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M5T51_RS04135 (836815) | 836815..838548 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T256305 WP_002916310.1 NZ_CP103714:834138-834548 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |