Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 687254..687933 | Replicon | chromosome |
Accession | NZ_CP103714 | ||
Organism | Klebsiella pneumoniae strain ST15 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A0C7K7A4 |
Locus tag | M5T51_RS03370 | Protein ID | WP_020324801.1 |
Coordinates | 687592..687933 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A0C7KEL2 |
Locus tag | M5T51_RS03365 | Protein ID | WP_020324792.1 |
Coordinates | 687254..687571 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T51_RS03340 (682468) | 682468..685620 | + | 3153 | WP_022631414.1 | AIDA repeat-containing protein | - |
M5T51_RS03345 (685713) | 685713..685952 | + | 240 | WP_020324820.1 | DUF905 domain-containing protein | - |
M5T51_RS03350 (686055) | 686055..686513 | + | 459 | WP_020324813.1 | antirestriction protein | - |
M5T51_RS03355 (686529) | 686529..687005 | + | 477 | WP_020324797.1 | RadC family protein | - |
M5T51_RS03360 (687014) | 687014..687241 | + | 228 | WP_020324796.1 | DUF987 domain-containing protein | - |
M5T51_RS03365 (687254) | 687254..687571 | + | 318 | WP_020324792.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M5T51_RS03370 (687592) | 687592..687933 | + | 342 | WP_020324801.1 | TA system toxin CbtA family protein | Toxin |
M5T51_RS03375 (688049) | 688049..688882 | + | 834 | WP_020324805.1 | DUF4942 domain-containing protein | - |
M5T51_RS03385 (689185) | 689185..689691 | + | 507 | WP_002917636.1 | G/U mismatch-specific DNA glycosylase | - |
M5T51_RS03390 (689791) | 689791..691632 | - | 1842 | WP_004174339.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12818.91 Da Isoelectric Point: 9.1484
>T256304 WP_020324801.1 NZ_CP103714:687592-687933 [Klebsiella pneumoniae]
MKTLPAIISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRNGF
VWQEQSPYLRAVDILRARQATGLLRQSRNNAIR
MKTLPAIISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRNGF
VWQEQSPYLRAVDILRARQATGLLRQSRNNAIR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0C7K7A4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0C7KEL2 |