Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 68357..68958 | Replicon | plasmid pMB3266_2 |
Accession | NZ_CP103712 | ||
Organism | Escherichia coli O25b:H4-ST131 |
Toxin (Protein)
Gene name | doc | Uniprot ID | V0AJ64 |
Locus tag | M5S69_RS25665 | Protein ID | WP_001216034.1 |
Coordinates | 68357..68737 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | M5S69_RS25670 | Protein ID | WP_001190712.1 |
Coordinates | 68737..68958 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S69_RS25630 (64129) | 64129..64989 | - | 861 | WP_000027057.1 | broad-spectrum class A beta-lactamase TEM-1 | - |
M5S69_RS25635 (65121) | 65121..65825 | + | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
M5S69_RS25640 (65974) | 65974..66954 | + | 981 | WP_000019407.1 | IS5-like element IS5 family transposase | - |
M5S69_RS25645 (67164) | 67164..67499 | + | 336 | WP_169329198.1 | type I deoxyribonuclease HsdR | - |
M5S69_RS25650 (67449) | 67449..67862 | - | 414 | Protein_87 | integrase core domain-containing protein | - |
M5S69_RS25655 (67867) | 67867..68145 | - | 279 | Protein_88 | pdcB | - |
M5S69_RS25660 (68173) | 68173..68352 | - | 180 | WP_001513661.1 | hypothetical protein | - |
M5S69_RS25665 (68357) | 68357..68737 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
M5S69_RS25670 (68737) | 68737..68958 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M5S69_RS25675 (69141) | 69141..70697 | + | 1557 | WP_001617892.1 | type I restriction-modification system subunit M | - |
M5S69_RS25680 (70694) | 70694..71977 | + | 1284 | WP_001617890.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B | - | 1..81007 | 81007 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T256302 WP_001216034.1 NZ_CP103712:c68737-68357 [Escherichia coli O25b:H4-ST131]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AJ64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |